Citrus Sinensis ID: 020615

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MAFSFSSLMVTLALGFLVVFTGKSSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGPSWNVKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCVAFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKHLLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRKNCRRPN

ccccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccccccHHcHHHHcccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHcccccHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccccccccccc

****FSSLMVTLALGFLVVFTGKSSAQLSTNFYSKTCPKLLNTVKSAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGPSWNVKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCVAFRNRIYNESNIESSFAKNRRGNCPR****GDNNLAPLDFQSPNKFDNQYYKHLLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIGEIRKNCRRPN

xxxxxHHHHHHHHHHHHxxHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peroxidase 4	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.	confident	A7NY33
Peroxidase P7	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.	probable	P00434
Peroxidase 68	Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.	probable	Q9LVL1

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.11.-.-	Acting on a peroxide as acceptor.	probable
1.11.1.-	Peroxidases.	probable
1.11.1.7	Peroxidase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SCH, chain A
Confidence level:very confident
Coverage over the Query: 28-323
View the alignment between query and template
View the model in PyMOL