Citrus Sinensis ID: 020623

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MHGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKDDEEPSRVGTSDQSEHARSTVSRAENDEYRSGEKED

cccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHcccCEEEEEcccccHHHHHHHHHHHcccEEEEEECcccHHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHcccccEEcccHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHcccccccccEEEEEcccccEEEccccccccccccHHHHHHHHHHHHcccccEEEcccccccccEEEEEccEEEEEEEHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc

*HGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRT****VAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGK************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein disulfide isomerase-like 5-2	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds. May play a role in storage protein biogenesis.	probable	Q0JD42
Protein disulfide-isomerase 5-2	Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.	probable	Q94F09

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F8U, chain A
Confidence level:very confident
Coverage over the Query: 2-289
View the alignment between query and template
View the model in PyMOL