Citrus Sinensis ID: 020623


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MHGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKDDEEPSRVGTSDQSEHARSTVSRAENDEYRSGEKED
cccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHcccEEEEEEEcccHHHHHHccccccccEEEEcccccccccccccccHHHHHHHHHHcccccEEcccHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHcccccccccEEEEEcccccEEEcccccccccccHHHHHHHHHHHHHcccccEEEcccccccccEEEEEccEEEEEEEHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc
cccccccccccccHHHHHHHHHHHcccccEEEccHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHccEEEEEccccHHHEEEcccccccEEEEEccccccccEEcccccHHHHHHHHHHcccccEEEccHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHccccccccccEEEEEccccEEEEEEccccccccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHccccccccc
mhgipteyygprKAELLVRYLKKfvapdvsilnsdaevsdfvenagtffplfigfgldESVMSNLALKYKKKAWFAVAkdfsedtmvlydfdkvpalvalqpsynehnifygpfdEEFLEEFIKqnflplsvpinqdtlnllkddKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEankksklpkmvvwdgneNYLTvigsesideedqgsQISRFLEGYRegrteqkkvagpsifgFVNSLIGIRSVYIIVFMVAMLMLLRTlgkddeepsrvgtsdqseharstvsraendeyrsgeked
mhgipteyygprKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAivedeteeksqKLVTTLKAAASANRELVFCYVGIKQFADFADTFEAnkksklpkmvvwdgNENYLTVIgsesideedqgsQISRFLEGYREGrteqkkvagpsifGFVNSLIGIRSVYIIVFMVAMLMLLRTLGkddeepsrvgtsdqseharstvsraendeyrsgeked
MHGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKDDEEPSRVGTSDQSEHARSTVSRAENDEYRSGEKED
*******YYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAI***************LKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIG*****************************VAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTL**************************************
*HGIPTEYYGPRKAELLVRYLKKFVA**********EVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRT***********GFVNSLIGIRSVYIIVFMVAMLMLLRTLGK************************************
MHGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGK************************************
*****TEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKD***********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEGYREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKDDEEPSRVGTSDQSEHARSTVSRAENDEYRSGEKED
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query323 2.2.26 [Sep-21-2011]
Q94F09440 Protein disulfide-isomera yes no 0.981 0.720 0.639 1e-121
Q0JD42423 Protein disulfide isomera yes no 0.910 0.695 0.603 1e-104
Q0E0I1425 Protein disulfide isomera no no 0.904 0.687 0.544 2e-86
Q54EN4513 Protein disulfide-isomera yes no 0.538 0.339 0.313 1e-08
Q67IX6563 Protein disulfide isomera no no 0.541 0.310 0.287 4e-05
>sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=2 SV=1 Back     alignment and function desciption
 Score =  434 bits (1117), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 211/330 (63%), Positives = 267/330 (80%), Gaps = 13/330 (3%)

Query: 2   HGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESV 61
           HG+P EYYGPRKA+LLVRYLKKFVAPDV++L SD+ V +FVE+AGTFFP+FIGFGL+ES+
Sbjct: 115 HGVPMEYYGPRKADLLVRYLKKFVAPDVAVLESDSTVKEFVEDAGTFFPVFIGFGLNESI 174

Query: 62  MSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEE 121
           +S L  KYKKKAWFAV+K+ SEDTMV YDFDK PALVA  P+YNEH++FYGPF++ FLEE
Sbjct: 175 ISGLGRKYKKKAWFAVSKEVSEDTMVSYDFDKAPALVANHPTYNEHSVFYGPFEDGFLEE 234

Query: 122 FIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVF 181
           F+KQ+FLPL +PIN DTL LLKDD+RKIVL IVEDET E  +KL   L+AAA ANR+LVF
Sbjct: 235 FVKQSFLPLILPINHDTLKLLKDDERKIVLTIVEDETHESLEKLYKALRAAAHANRDLVF 294

Query: 182 CYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESI-DEEDQGSQISRFLEG 240
            YVG+KQF +F D+F  +KK+ LPK+VVWDG+E Y  V G E+I  EED  +Q+SRFLEG
Sbjct: 295 GYVGVKQFEEFVDSFHVDKKTNLPKIVVWDGDEEYDQVTGIETITQEEDHLTQVSRFLEG 354

Query: 241 YREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKDDEEPSRVGTS-- 298
           YREGRTE+KK+ GPS  GF+NS+IGIRSVYI+VF+VA++M+LR+LG+  EEP+ V T+  
Sbjct: 355 YREGRTEKKKINGPSFMGFINSMIGIRSVYILVFLVAVIMMLRSLGQ-VEEPTGVRTATA 413

Query: 299 -----DQSEHARSTVSRAENDEYRSGEKED 323
                DQ+    +TV   E+ E++  +K++
Sbjct: 414 VRERVDQA----TTVPEDESSEHKPSDKKE 439




Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.
Arabidopsis thaliana (taxid: 3702)
>sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 Back     alignment and function description
>sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=2 SV=1 Back     alignment and function description
>sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 Back     alignment and function description
>sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
255586469 433 protein disulfide isomerase, putative [R 0.990 0.739 0.687 1e-129
224135931419 predicted protein [Populus trichocarpa] 0.984 0.758 0.705 1e-128
225470790 438 PREDICTED: protein disulfide-isomerase 5 0.993 0.732 0.661 1e-125
321266521422 protein disulfide isomerase-like protein 0.990 0.758 0.671 1e-125
297846626 440 hypothetical protein ARALYDRAFT_473690 [ 0.993 0.729 0.647 1e-120
18399786 440 protein PDI-like 5-2 [Arabidopsis thalia 0.981 0.720 0.639 1e-119
8778373 473 F15O4.20 [Arabidopsis thaliana] 0.990 0.676 0.645 1e-119
224145166398 predicted protein [Populus trichocarpa] 0.863 0.701 0.720 1e-116
449528051369 PREDICTED: protein disulfide-isomerase 5 0.996 0.872 0.642 1e-113
449441752 441 PREDICTED: protein disulfide-isomerase 5 0.996 0.730 0.642 1e-113
>gi|255586469|ref|XP_002533878.1| protein disulfide isomerase, putative [Ricinus communis] gi|223526179|gb|EEF28509.1| protein disulfide isomerase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/323 (68%), Positives = 275/323 (85%), Gaps = 3/323 (0%)

Query: 1   MHGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDES 60
           MHG+P +YYGPRKA+LLVRYLKKFVAPDV++L+SD  ++DFV+ AG  FP+FIGFG++E+
Sbjct: 114 MHGVPVDYYGPRKADLLVRYLKKFVAPDVAVLDSDVAITDFVQEAGMSFPIFIGFGVNET 173

Query: 61  VMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLE 120
           ++SNL LKYKKKAWF+VA DFSE  MV YDFDKVPALVA+ PSYNE +IFYGPF+E+FLE
Sbjct: 174 MVSNLGLKYKKKAWFSVANDFSEGVMVQYDFDKVPALVAVHPSYNEQSIFYGPFEEKFLE 233

Query: 121 EFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELV 180
           +FIKQNFLP +VP+N DTL +LKDD+RKIVL I+EDE++EKSQKL+  LKAAASANR+LV
Sbjct: 234 DFIKQNFLPPAVPMNHDTLKILKDDERKIVLTIMEDESDEKSQKLIKLLKAAASANRDLV 293

Query: 181 FCYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESIDEEDQGSQISRFLEG 240
           F YVG+KQ+  FADTF  NKK+KLPKMVVW+G+E YL VIG ES+++EDQGSQIS FLEG
Sbjct: 294 FGYVGVKQWEGFADTFGGNKKTKLPKMVVWNGDEEYLLVIGLESLEDEDQGSQISLFLEG 353

Query: 241 YREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKDDEEPSRVGTSDQ 300
           YR+G+T QK+++GPS  G++NSLIGIR+VYIIVFMVAMLML++T+GK  EEP RVGT DQ
Sbjct: 354 YRKGQTIQKQLSGPSFMGYINSLIGIRTVYIIVFMVAMLMLIQTIGK--EEPLRVGTRDQ 411

Query: 301 SEHARSTVSRAENDEYRSGEKED 323
            E   S+   +    Y  G+K+D
Sbjct: 412 VEDVSSSEPESST-AYGPGDKQD 433




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224135931|ref|XP_002327339.1| predicted protein [Populus trichocarpa] gi|222835709|gb|EEE74144.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225470790|ref|XP_002269656.1| PREDICTED: protein disulfide-isomerase 5-2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|321266521|gb|ADW78597.1| protein disulfide isomerase-like protein [Hibiscus cannabinus] Back     alignment and taxonomy information
>gi|297846626|ref|XP_002891194.1| hypothetical protein ARALYDRAFT_473690 [Arabidopsis lyrata subsp. lyrata] gi|297337036|gb|EFH67453.1| hypothetical protein ARALYDRAFT_473690 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18399786|ref|NP_564462.1| protein PDI-like 5-2 [Arabidopsis thaliana] gi|75332171|sp|Q94F09.1|PDI52_ARATH RecName: Full=Protein disulfide-isomerase 5-2; Short=AtPDIL5-2; AltName: Full=Protein disulfide-isomerase 7-1; Short=AtPDIL7-1; AltName: Full=Protein disulfide-isomerase 8; Short=PDI8; Flags: Precursor gi|14423498|gb|AAK62431.1|AF386986_1 Unknown protein [Arabidopsis thaliana] gi|31376373|gb|AAP49513.1| At1g35620 [Arabidopsis thaliana] gi|332193697|gb|AEE31818.1| protein PDI-like 5-2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8778373|gb|AAF79381.1|AC007887_40 F15O4.20 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224145166|ref|XP_002325550.1| predicted protein [Populus trichocarpa] gi|222862425|gb|EEE99931.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449528051|ref|XP_004171020.1| PREDICTED: protein disulfide-isomerase 5-2-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449441752|ref|XP_004138646.1| PREDICTED: protein disulfide-isomerase 5-2-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
TAIR|locus:2014681440 PDIL5-2 "PDI-like 5-2" [Arabid 0.990 0.727 0.649 1.6e-111
DICTYBASE|DDB_G0291434513 pdi2 "protein disulfide isomer 0.557 0.350 0.309 3e-11
RGD|3244509 P4hb "prolyl 4-hydroxylase, be 0.712 0.451 0.248 1.8e-06
UNIPROTKB|P12244508 P12244 "Dolichyl-diphosphoolig 0.708 0.450 0.247 3e-06
ZFIN|ZDB-GENE-080610-1509 p4hb "procollagen-proline, 2-o 0.551 0.349 0.270 6.4e-06
UNIPROTKB|P05307510 P4HB "Protein disulfide-isomer 0.702 0.445 0.265 6.5e-06
UNIPROTKB|A6H7J6510 P4HB "Prolyl 4-hydroxylase, be 0.702 0.445 0.265 8.3e-06
TAIR|locus:2082712579 PDIL1-3 "PDI-like 1-3" [Arabid 0.628 0.350 0.255 1.7e-05
TAIR|locus:2036906501 PDIL1-1 "AT1G21750" [Arabidops 0.724 0.467 0.238 1.8e-05
UNIPROTKB|P07237508 P4HB "Protein disulfide-isomer 0.702 0.446 0.261 5e-05
TAIR|locus:2014681 PDIL5-2 "PDI-like 5-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1101 (392.6 bits), Expect = 1.6e-111, P = 1.6e-111
 Identities = 213/328 (64%), Positives = 269/328 (82%)

Query:     2 HGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESV 61
             HG+P EYYGPRKA+LLVRYLKKFVAPDV++L SD+ V +FVE+AGTFFP+FIGFGL+ES+
Sbjct:   115 HGVPMEYYGPRKADLLVRYLKKFVAPDVAVLESDSTVKEFVEDAGTFFPVFIGFGLNESI 174

Query:    62 MSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPALVALQPSYNEHNIFYGPFDEEFLEE 121
             +S L  KYKKKAWFAV+K+ SEDTMV YDFDK PALVA  P+YNEH++FYGPF++ FLEE
Sbjct:   175 ISGLGRKYKKKAWFAVSKEVSEDTMVSYDFDKAPALVANHPTYNEHSVFYGPFEDGFLEE 234

Query:   122 FIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRELVF 181
             F+KQ+FLPL +PIN DTL LLKDD+RKIVL IVEDET E  +KL   L+AAA ANR+LVF
Sbjct:   235 FVKQSFLPLILPINHDTLKLLKDDERKIVLTIVEDETHESLEKLYKALRAAAHANRDLVF 294

Query:   182 CYVGIKQFADFADTFEANKKSKLPKMVVWDGNENYLTVIGSESI-DEEDQGSQISRFLEG 240
              YVG+KQF +F D+F  +KK+ LPK+VVWDG+E Y  V G E+I  EED  +Q+SRFLEG
Sbjct:   295 GYVGVKQFEEFVDSFHVDKKTNLPKIVVWDGDEEYDQVTGIETITQEEDHLTQVSRFLEG 354

Query:   241 YREGRTEQKKVAGPSIFGFVNSLIGIRSVYIIVFMVAMLMLLRTLGKDDEEPSRVGTS-- 298
             YREGRTE+KK+ GPS  GF+NS+IGIRSVYI+VF+VA++M+LR+LG+  EEP+ V T+  
Sbjct:   355 YREGRTEKKKINGPSFMGFINSMIGIRSVYILVFLVAVIMMLRSLGQV-EEPTGVRTATA 413

Query:   299 --DQSEHARSTVSRAENDEYR-SGEKED 323
               ++ + A +TV   E+ E++ S +KED
Sbjct:   414 VRERVDQA-TTVPEDESSEHKPSDKKED 440




GO:0006662 "glycerol ether metabolic process" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0009505 "plant-type cell wall" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0003756 "protein disulfide isomerase activity" evidence=ISS
GO:0009506 "plasmodesma" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
GO:0030244 "cellulose biosynthetic process" evidence=RCA
GO:0048193 "Golgi vesicle transport" evidence=RCA
DICTYBASE|DDB_G0291434 pdi2 "protein disulfide isomerase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|3244 P4hb "prolyl 4-hydroxylase, beta polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P12244 P12244 "Dolichyl-diphosphooligosaccharide--protein glycotransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080610-1 p4hb "procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), beta polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P05307 P4HB "Protein disulfide-isomerase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7J6 P4HB "Prolyl 4-hydroxylase, beta subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TAIR|locus:2082712 PDIL1-3 "PDI-like 1-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036906 PDIL1-1 "AT1G21750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P07237 P4HB "Protein disulfide-isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0JD42PDI52_ORYSJNo assigned EC number0.60330.91020.6950yesno
Q94F09PDI52_ARATHNo assigned EC number0.63930.98140.7204yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
TIGR01130462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 1e-10
pfam13848183 pfam13848, Thioredoxin_6, Thioredoxin-like domain 4e-07
PTZ00102477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 5e-05
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
 Score = 61.6 bits (150), Expect = 1e-10
 Identities = 55/257 (21%), Positives = 96/257 (37%), Gaps = 25/257 (9%)

Query: 5   PTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSN 64
            ++Y GPR A+ +V+Y+KK   P V  + + A++  F+ +      + IGF   + + S 
Sbjct: 89  VSDYNGPRDADGIVKYMKKQSGPAVKEIETVADLEAFLADD---DVVVIGF--FKDLDSE 143

Query: 65  LALKYKKKA------WFAVAKDFSEDTMVLYD-FDKVPALVALQPSYNEHNIFYG--PFD 115
           L   +   A      +F  A             F     L   +    + +   G    D
Sbjct: 144 LNDTFLSVAEKLRDVYFFFAHSSDVAAFAKLGAFPDSVVLFKPKDEDEKFSKVDGEMDTD 203

Query: 116 EEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASA 175
              LE+FI+   LPL     Q+T     +    +VL    DE+ +  ++L      AA  
Sbjct: 204 VSDLEKFIRAESLPLVGEFTQETAAKYFESGPLVVLYYNVDESLDPFEELRNRFLEAAKK 263

Query: 176 NR--ELVFCYVGIKQFADFADTFEANKKSKLPKMVVWDGNEN--YLTVIGSESIDEEDQG 231
            R   + F     + F    + F   K  K P + + D   N  Y          EE   
Sbjct: 264 FRGKFVNFAVADEEDFGRELEYFGL-KAEKFPAVAIQDLEGNKKYPMD------QEEFSS 316

Query: 232 SQISRFLEGYREGRTEQ 248
             +  F++ + +G+ + 
Sbjct: 317 ENLEAFVKDFLDGKLKP 333


This model represents eukaryotic protein disulfide isomerases retained in the endoplasmic reticulum (ER) and closely related forms. Some members have been assigned alternative or additional functions such as prolyl 4-hydroxylase and dolichyl-diphosphooligosaccharide-protein glycotransferase. Members of this family have at least two protein-disulfide domains, each similar to thioredoxin but with the redox-active disulfide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs). Length = 462

>gnl|CDD|222416 pfam13848, Thioredoxin_6, Thioredoxin-like domain Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 323
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 100.0
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.96
PTZ00102477 disulphide isomerase; Provisional 99.96
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 99.93
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 99.93
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 99.91
KOG4277468 consensus Uncharacterized conserved protein, conta 99.69
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 99.64
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 99.52
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 99.5
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.23
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 99.22
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 99.2
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 99.14
PTZ00102477 disulphide isomerase; Provisional 99.13
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 99.01
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.88
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 98.85
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 98.79
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.44
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 98.42
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.34
cd03071116 PDI_b'_NRX PDIb' family, NRX subgroup, redox inact 98.27
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 98.19
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 98.17
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 98.16
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.07
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 98.02
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 97.99
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 97.9
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 97.89
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 97.89
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 97.87
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 97.87
PRK10996139 thioredoxin 2; Provisional 97.83
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 97.83
PRK09381109 trxA thioredoxin; Provisional 97.75
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.69
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 97.68
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 97.68
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 97.68
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 97.64
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 97.62
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 97.62
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 97.61
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 97.57
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 97.57
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 97.55
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.53
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 97.5
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 97.47
PTZ00443224 Thioredoxin domain-containing protein; Provisional 97.47
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 97.43
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 97.41
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 97.4
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 97.33
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 97.33
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 97.32
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 97.29
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 97.28
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 97.24
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 97.23
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 97.22
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 97.22
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 97.2
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.17
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 97.15
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 97.13
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 97.11
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 97.08
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 97.04
cd0307091 PDI_b_ERp44 PDIb family, ERp44 subfamily, first re 97.04
PRK10996139 thioredoxin 2; Provisional 97.03
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 97.02
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 97.01
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 96.99
PTZ0005198 thioredoxin; Provisional 96.99
PRK09381109 trxA thioredoxin; Provisional 96.95
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 96.95
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 96.94
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 96.94
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 96.93
cd0294793 TRX_family TRX family; composed of two groups: Gro 96.93
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 96.92
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 96.84
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 96.84
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 96.83
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 96.81
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 96.79
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 96.7
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 96.66
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 96.64
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 96.58
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 96.55
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 96.54
PHA02278103 thioredoxin-like protein 96.49
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 96.48
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 96.44
cd02962152 TMX2 TMX2 family; composed of proteins similar to 96.35
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 96.35
PTZ00443224 Thioredoxin domain-containing protein; Provisional 96.34
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 96.28
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.26
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 96.25
PLN02309457 5'-adenylylsulfate reductase 96.21
KOG4277 468 consensus Uncharacterized conserved protein, conta 96.18
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 96.17
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 96.16
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 96.15
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 96.13
PLN02309457 5'-adenylylsulfate reductase 96.1
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.06
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 96.03
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 95.79
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 95.77
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 95.72
PTZ0005198 thioredoxin; Provisional 95.65
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 95.63
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 95.49
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 95.27
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 95.26
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 95.23
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 95.01
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 94.96
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 94.91
PHA02278103 thioredoxin-like protein 94.87
cd0294793 TRX_family TRX family; composed of two groups: Gro 94.82
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 94.7
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 94.67
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 94.66
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 94.62
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 94.61
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 94.61
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 94.44
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 94.25
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 94.23
PTZ00062204 glutaredoxin; Provisional 94.01
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 93.79
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 93.75
KOG0907106 consensus Thioredoxin [Posttranslational modificat 93.21
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 92.87
PTZ00062204 glutaredoxin; Provisional 92.78
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 92.76
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 92.52
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 92.34
KOG0907106 consensus Thioredoxin [Posttranslational modificat 92.12
KOG0908288 consensus Thioredoxin-like protein [Posttranslatio 92.08
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 91.97
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 91.6
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 91.55
cd02962152 TMX2 TMX2 family; composed of proteins similar to 91.34
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 91.25
cd02955124 SSP411 TRX domain, SSP411 protein family; members 91.14
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 90.61
PRK03147173 thiol-disulfide oxidoreductase; Provisional 89.91
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 89.88
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 89.7
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 89.52
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 88.5
KOG2603331 consensus Oligosaccharyltransferase, gamma subunit 88.24
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 86.98
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 86.47
KOG1672211 consensus ATP binding protein [Posttranslational m 86.37
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 86.21
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 85.51
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 84.11
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 84.1
TIGR02740271 TraF-like TraF-like protein. This protein is relat 83.44
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 83.31
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 82.61
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 82.44
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 81.73
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 81.44
cd02958114 UAS UAS family; UAS is a domain of unknown functio 81.39
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=5.8e-40  Score=314.04  Aligned_cols=275  Identities=20%  Similarity=0.292  Sum_probs=231.1

Q ss_pred             CCc-ccccCCCCChHHHHHHHHHhcCCCceecCChHHHHHHHHhcCCcccEEEEecCC----hhHHHHHHHhhcCceeEE
Q 020623            2 HGI-PTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLD----ESVMSNLALKYKKKAWFA   76 (323)
Q Consensus         2 ~G~-~~eY~G~R~a~~Iv~~l~k~~~p~v~~i~s~~~l~~fl~~~~~~~~~vVgf~~~----~~~f~~~A~~~~~~~~F~   76 (323)
                      ||. +.+|+|+|++++||.||+++++|+++.|.+.++++.|+...+   +++||||.+    .+.|...|..+++++.|+
T Consensus       108 nG~~~~~Y~G~r~adgIv~wl~kq~gPa~~~l~~~~~a~~~l~~~~---~~vig~F~d~~~~~~~~~~~a~~l~~d~~F~  184 (493)
T KOG0190|consen  108 NGRSAQDYNGPREADGIVKWLKKQSGPASKTLKTVDEAEEFLSKKD---VVVIGFFKDLESLAESFFDAASKLRDDYKFA  184 (493)
T ss_pred             cCCcceeccCcccHHHHHHHHHhccCCCceecccHHHHHhhccCCc---eEEEEEecccccchHHHHHHHHhccccceee
Confidence            687 599999999999999999999999999999999999999977   479998763    346778888999999999


Q ss_pred             eecccchhhHhhcCCCC--CCeEEEecCCCCCCccccCCCCHHHHHHHHHhhcCCCeeecChhhHHHhhcCCCcE-EEEE
Q 020623           77 VAKDFSEDTMVLYDFDK--VPALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKI-VLAI  153 (323)
Q Consensus        77 ~~~~~~~~~~~~~~~~~--~p~ivv~k~~~~~~~~y~g~~~~~~L~~fI~~~~~Plv~~~t~~~~~~~~~~~~~~-v~~f  153 (323)
                      ++  .+.+++.++++..  .+.++++++.++....|+|+++.+.|.+||+.+++|+|+++|.++...++.+..+. +++|
T Consensus       185 ~t--s~~~~~~~~~~~~~~~~~i~l~kk~d~~~~~~~~~~~~~~l~~Fi~~~~~plv~~ft~~~~~~~~~~~~~~~~~~~  262 (493)
T KOG0190|consen  185 HT--SDSDVAKKLELNTEGTFPIVLFKKFDELLVKYDGSFTPELLKKFIQENSLPLVTEFTVANNAKIYSSFVKLGLDFF  262 (493)
T ss_pred             cc--CcHhHHhhccCCCCCcceEEeccccccchhhcccccCHHHHHHHHHHhcccccceecccccceeeccccccceeEE
Confidence            87  5678888777632  34588888865556667899999999999999999999999999998888765444 3445


Q ss_pred             EeCCChhHHHHHHHHHHHHHHhCCC-eEEEEEcCcchhhHhhhcCCcCCCCCC-eEEEEeCC-cceeeccCCCCCCCCCC
Q 020623          154 VEDETEEKSQKLVTTLKAAASANRE-LVFCYVGIKQFADFADTFEANKKSKLP-KMVVWDGN-ENYLTVIGSESIDEEDQ  230 (323)
Q Consensus       154 ~~~~~~e~~~~~~~~l~~~A~~~~~-l~F~~vd~~~~~~~~~~~gl~~~~~~P-~ivI~~~~-~kY~~~~~~~~~~~~~t  230 (323)
                      ++. .....+.+++.++++|++||+ ++|+++|...+++.++.||+ .....| .+++.+.+ +||.+.      .++++
T Consensus       263 ~~~-~~~~~e~~~~~~~~vAk~f~~~l~Fi~~d~e~~~~~~~~~Gl-~~~~~~~~~v~~~~~~~Ky~~~------~e~~~  334 (493)
T KOG0190|consen  263 VFF-KCNRFEELRKKFEEVAKKFKGKLRFILIDPESFARVLEFFGL-EEEQLPIRAVILNEDGSKYPLE------EEELD  334 (493)
T ss_pred             ecc-ccccHHHHHHHHHHHHHhcccceEEEEEChHHhhHHHHhcCc-ccccCCeeEEeeccccccccCc------ccccc
Confidence            543 223568899999999999998 99999999999999999999 667777 44445544 577653      34578


Q ss_pred             HHHHHHHHHHHHcCcccccccCC--CCCC--CCeeEEeccCcceehHHH--HHHHHHHHHhcCCC
Q 020623          231 GSQISRFLEGYREGRTEQKKVAG--PSIF--GFVNSLIGIRSVYIIVFM--VAMLMLLRTLGKDD  289 (323)
Q Consensus       231 ~~~I~~Fi~~~~~Gkl~~~~kSe--P~~~--g~v~~vVg~~~~~iv~~~--~~~~~~~~~~~~~~  289 (323)
                      .++|.+|+.+|++|+++|++||+  |+.|  ++||+|||+||+.||+--  ..++.+...|||||
T Consensus       335 ~~~ie~f~~~~l~Gk~~p~~kSqpiPe~~~~~pVkvvVgknfd~iv~de~KdVLvEfyAPWCgHC  399 (493)
T KOG0190|consen  335 QENIESFVKDFLDGKVKPHLKSQPIPEDNDRSPVKVVVGKNFDDIVLDEGKDVLVEFYAPWCGHC  399 (493)
T ss_pred             HHHHHHHHHHHhcCccccccccCCCCcccccCCeEEEeecCHHHHhhccccceEEEEcCcccchh
Confidence            88999999999999999999999  7777  799999999999999964  88999999999999



>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd03070 PDI_b_ERp44 PDIb family, ERp44 subfamily, first redox inactive TRX-like domain b; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 4e-27
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 8e-27
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 1e-24
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 3e-17
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 5e-15
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 3e-12
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 1e-10
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 4e-08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-07
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 4e-07
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 1e-05
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 2e-04
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
 Score =  108 bits (271), Expect = 4e-27
 Identities = 42/260 (16%), Positives = 89/260 (34%), Gaps = 25/260 (9%)

Query: 2   HGIPTEYYGPRKAELLVRYLKKFVAPDVSILNSDAEVSDFVENAGTFFPLFIGFGLDESV 61
                EY G   A+ LV +L   +   V ++  + E+  F           IG+  ++  
Sbjct: 100 EDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIED--EIKLIGYFKNKD- 156

Query: 62  MSNLALKYKKKAWFAVAKDFSEDTMVLYDFD---------KVPALVALQPSYNEHNIFYG 112
                     KA+   A++F         FD         K+  +   +    E      
Sbjct: 157 ------SEHYKAFKEAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPD 210

Query: 113 -PFDEEFLEEFIKQNFLPLSVPINQDTLN-LLKDDKRKIVLAIVEDETEEKSQKLVTTLK 170
            P  EE +  F++++       +  +++    +DD   I +    +E +    + +  LK
Sbjct: 211 KPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGYEFLEILK 270

Query: 171 AAASANRE---LVFCYVGIKQFADFADTFEANKKSKL--PKMVVWDGNENYLTVIGSESI 225
           + A  N +   L   ++    F      +E      L  P++ V +  +     +  +  
Sbjct: 271 SVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWMEMDDE 330

Query: 226 DEEDQGSQISRFLEGYREGR 245
           ++     ++  +LE   EG 
Sbjct: 331 EDLPSAEELEDWLEDVLEGE 350


>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Length = 250 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Length = 147 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Length = 133 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 100.0
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 100.0
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 100.0
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 100.0
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 99.97
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.97
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.97
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 99.96
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.96
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 99.88
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.81
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.74
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 99.66
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.52
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.46
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 99.45
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.34
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.32
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.24
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.21
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.2
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.14
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.99
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.99
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 98.91
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 98.72
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.7
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 98.58
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 98.48
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 98.47
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 98.19
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 98.18
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 98.12
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 98.1
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 98.1
2l5l_A136 Thioredoxin; structural genomics, electron transpo 98.06
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 98.05
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 98.02
2yzu_A109 Thioredoxin; redox protein, electron transport, st 98.02
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 98.02
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 98.01
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 98.0
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 98.0
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 97.99
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 97.96
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.96
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 97.96
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 97.94
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 97.94
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 97.93
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 97.93
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 97.91
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 97.91
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 97.91
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 97.9
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 97.89
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 97.89
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 97.85
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 97.84
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 97.84
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 97.84
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 97.83
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 97.83
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 97.83
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 97.83
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 97.83
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 97.82
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.8
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 97.8
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 97.79
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 97.77
2l57_A126 Uncharacterized protein; structural genomics, unkn 97.76
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 97.74
4euy_A105 Uncharacterized protein; structural genomics, PSI- 97.71
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 97.71
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 97.68
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.67
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 97.66
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 97.66
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 97.65
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 97.63
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 97.61
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.61
2qsi_A137 Putative hydrogenase expression/formation protein; 97.61
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 97.6
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 97.59
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 97.58
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 97.58
1mek_A120 Protein disulfide isomerase; electron transport, r 97.58
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 97.56
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 97.56
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 97.55
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 97.54
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 97.51
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 97.48
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 97.47
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 97.44
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 97.42
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 97.42
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 97.41
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 97.41
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 97.41
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 97.4
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 97.4
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 97.38
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 97.37
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 97.36
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 97.33
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 97.33
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 97.32
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 97.32
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 97.32
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 97.32
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 97.31
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 97.31
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 97.3
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 97.26
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 97.25
1mek_A120 Protein disulfide isomerase; electron transport, r 97.25
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 97.24
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.23
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 97.23
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 97.21
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.2
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.19
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.19
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 97.18
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 97.17
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 97.13
2yzu_A109 Thioredoxin; redox protein, electron transport, st 97.12
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 97.11
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 97.11
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 97.09
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 97.07
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 97.07
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 97.05
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 97.04
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 97.04
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 97.04
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 97.02
2qsi_A137 Putative hydrogenase expression/formation protein; 96.99
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 96.98
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 96.98
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 96.98
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 96.98
1zma_A118 Bacterocin transport accessory protein; alpha-beta 96.93
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 96.93
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 96.9
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 96.87
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 96.87
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 96.84
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 96.83
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 96.82
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 95.86
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 96.79
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 96.79
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 96.79
4euy_A105 Uncharacterized protein; structural genomics, PSI- 96.78
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 96.77
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 96.74
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 96.74
2l5l_A136 Thioredoxin; structural genomics, electron transpo 96.74
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 96.73
1zma_A118 Bacterocin transport accessory protein; alpha-beta 96.7
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 96.7
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 96.69
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 96.68
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 96.67
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 96.66
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 96.66
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 96.65
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 96.64
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 96.64
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 96.62
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 96.62
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 96.58
2kuc_A130 Putative disulphide-isomerase; structural genomics 96.58
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 96.53
1wmj_A130 Thioredoxin H-type; structural genomics, program f 96.53
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 96.52
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 96.51
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 96.48
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 96.36
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 96.35
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 96.32
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 96.3
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 96.3
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 96.29
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.27
3raz_A151 Thioredoxin-related protein; structural genomics, 96.23
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 96.1
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 96.09
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.08
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 96.08
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 96.07
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 96.07
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 96.03
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 96.03
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 96.03
1wmj_A130 Thioredoxin H-type; structural genomics, program f 96.02
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 95.99
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 95.99
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 95.98
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 95.94
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 95.87
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 95.87
2l57_A126 Uncharacterized protein; structural genomics, unkn 95.77
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 95.76
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 95.73
2l5o_A153 Putative thioredoxin; structural genomics, unknown 95.71
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 95.68
2lrn_A152 Thiol:disulfide interchange protein; structural ge 95.67
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 95.62
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 95.6
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 95.57
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 95.56
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 95.52
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 95.44
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 95.39
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 95.37
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 95.36
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 95.27
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 95.24
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 95.13
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 95.02
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 94.99
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 94.97
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 94.88
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 94.83
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 94.73
4evm_A138 Thioredoxin family protein; structural genomics, n 94.49
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 94.32
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 94.24
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 94.24
2kuc_A130 Putative disulphide-isomerase; structural genomics 94.0
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 93.97
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 92.86
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 93.59
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 92.45
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 93.29
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 93.16
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 93.15
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 93.1
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 92.97
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 92.75
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 92.67
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 92.46
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 92.41
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 92.36
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 92.3
2ywi_A196 Hypothetical conserved protein; uncharacterized co 91.98
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 91.91
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 91.24
3f9u_A172 Putative exported cytochrome C biogenesis-related; 91.15
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 91.08
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 90.86
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 90.69
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 90.5
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 89.67
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 89.62
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 88.46
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 88.37
2lrt_A152 Uncharacterized protein; structural genomics, thio 88.21
3ira_A173 Conserved protein; methanosarcina mazei,structural 87.5
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 87.45
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 87.04
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 86.68
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 86.67
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 86.18
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 85.92
4evm_A138 Thioredoxin family protein; structural genomics, n 83.46
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 83.02
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 83.02
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 82.17
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 81.49
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 81.35
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 80.94
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 81.72
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=3.2e-34  Score=258.23  Aligned_cols=224  Identities=14%  Similarity=0.201  Sum_probs=179.2

Q ss_pred             hcCCCceecCChHHHHHHHHh-cCCcccEEEEecCC-----hhHHHHHHHhhcCceeEEeecccchhhHhhcCCCCCCeE
Q 020623           24 FVAPDVSILNSDAEVSDFVEN-AGTFFPLFIGFGLD-----ESVMSNLALKYKKKAWFAVAKDFSEDTMVLYDFDKVPAL   97 (323)
Q Consensus        24 ~~~p~v~~i~s~~~l~~fl~~-~~~~~~~vVgf~~~-----~~~f~~~A~~~~~~~~F~~~~~~~~~~~~~~~~~~~p~i   97 (323)
                      +++|+|+.|+|.+++++|++. ++   +++|||+.+     .+.|.++|..+++++.|+++  .+++++.+++++ .|+|
T Consensus         3 ~~gP~v~~l~s~~~~~~~~~~~~~---v~vVgff~~~~~~~~~~F~~~A~~lr~~~~F~~t--~~~~v~~~~~v~-~p~i   76 (250)
T 3ec3_A            3 LGSPPSKEILTLKQVQEFLKDGDD---VVILGVFQGVGDPGYLQYQDAANTLREDYKFHHT--FSTEIAKFLKVS-LGKL   76 (250)
T ss_dssp             --CCSSEECCCHHHHHHHHHHCSS---CEEEEECSCTTCHHHHHHHHHHHHHTTTCCEEEE--CCHHHHHHHTCC-SSEE
T ss_pred             CCCCCceecCCHHHHHHHHhcCCC---eEEEEEEcCCCchHHHHHHHHHHhhhcCcEEEEE--CcHHHHHHcCCC-CCeE
Confidence            689999999999999999998 77   489999864     24789999999999999998  577899899985 5999


Q ss_pred             EEecCC------CCCCcccc--CCCCHHHHHHHHHhhcCCCeeecChhhHHHhhcCCCcEEEEEEeCC---C-hhHHHHH
Q 020623           98 VALQPS------YNEHNIFY--GPFDEEFLEEFIKQNFLPLSVPINQDTLNLLKDDKRKIVLAIVEDE---T-EEKSQKL  165 (323)
Q Consensus        98 vv~k~~------~~~~~~y~--g~~~~~~L~~fI~~~~~Plv~~~t~~~~~~~~~~~~~~v~~f~~~~---~-~e~~~~~  165 (323)
                      ++||+.      ++....|+  |+++.++|.+||+.+++|+|+++|.+|+..++ .++|++++|+..+   + .+..+.+
T Consensus        77 vlfk~~~~~~kfde~~~~y~g~~~~~~~~l~~fi~~~~~Plv~e~t~~n~~~~~-~~~~l~~~~~~~d~~~~~~~~~~~~  155 (250)
T 3ec3_A           77 VLMQPEKFQSKYEPRMHVMDVQGSTEASAIKDYVVKHALPLVGHRKTSNDAKRY-SKRPLVVVYYSVDFSFDYRTATQFW  155 (250)
T ss_dssp             EEECCGGGCCTTSCSCEEEECCTTSCHHHHHHHHHHHSSCTEEEECTTTHHHHS-CSSSEEEEEECCCCSTTTHHHHHHH
T ss_pred             EEEecchhhccccccceeccCCCCCCHHHHHHHHHHcCCCceeecCccchhhhh-ccCccEEEEEecccccccchhHHHH
Confidence            999962      34567888  47999999999999999999999999999988 4789998888532   1 3445678


Q ss_pred             HHHHHHHHHhCCCeEEEEEcCcchhhHhhhcCCcCCCCC-CeEEEEeCC-cceeeccCCCCCCCCCCHHHHHHHHHHHHc
Q 020623          166 VTTLKAAASANRELVFCYVGIKQFADFADTFEANKKSKL-PKMVVWDGN-ENYLTVIGSESIDEEDQGSQISRFLEGYRE  243 (323)
Q Consensus       166 ~~~l~~~A~~~~~l~F~~vd~~~~~~~~~~~gl~~~~~~-P~ivI~~~~-~kY~~~~~~~~~~~~~t~~~I~~Fi~~~~~  243 (323)
                      ++.++++|++|+.++|+|+|+.++++.+++||+ +..+. |.+++++.+ .||.++      .+++|.++|.+|+++|++
T Consensus       156 ~~~~~~vAk~~kki~F~~~d~~~~~~~l~~fgl-~~~~~~p~~~~~~~~~~ky~~~------~~~~t~~~i~~Fv~~~~~  228 (250)
T 3ec3_A          156 RNKVLEVAKDFPEYTFAIADEEDYATEVKDLGL-SESGGDVNAAILDESGKKFAME------PEEFDSDALREFVMAFKK  228 (250)
T ss_dssp             HHHHHHHHTTCTTSEEEEEETTTTHHHHHHTTC-SSCSCSCEEEEECTTSCEEECC------CCSCCHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHhhcceeEEEEcHHHHHHHHHHcCC-CccCCCcEEEEEcCCCceecCC------cccCCHHHHHHHHHHHHC
Confidence            899999999999999999999999999999999 54444 688888864 477664      246899999999999999


Q ss_pred             CcccccccCC--CCCC-CCee
Q 020623          244 GRTEQKKVAG--PSIF-GFVN  261 (323)
Q Consensus       244 Gkl~~~~kSe--P~~~-g~v~  261 (323)
                      |+++|++|||  |+.+ |+|.
T Consensus       229 Gkl~p~~kSepiPe~~~~pV~  249 (250)
T 3ec3_A          229 GKLKPVIKSQPVPKNNKGAAA  249 (250)
T ss_dssp             TCCCCCC--------------
T ss_pred             CCccceeecCCCCCCCCCCCC
Confidence            9999999999  7766 8775



>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 323
d1bjxa_110 c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu 4e-06
d2djka1133 c.47.1.2 (A:1-133) Protein disulfide isomerase, PD 2e-05
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: PDI-like
domain: Protein disulfide isomerase, PDI
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.9 bits (101), Expect = 4e-06
 Identities = 25/118 (21%), Positives = 38/118 (32%), Gaps = 18/118 (15%)

Query: 29  VSILNSDAEVSDFVENAGTFFPLFIGFGLDESVMSNLALKYKKKAWFAVAKDFSEDTMVL 88
            + L   A     VE++       IGF  D             K +   A+   +    +
Sbjct: 2   ATTLPDGAAAESLVESSEVAV---IGFFKDVE-------SDSAKQFLQAAEAIDDIPFGI 51

Query: 89  YDFDKV--------PALVALQPSYNEHNIFYGPFDEEFLEEFIKQNFLPLSVPINQDT 138
                V          +V  +      N F G   +E L +FIK N LPL +   + T
Sbjct: 52  TSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTEQT 109


>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 133 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 99.89
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 99.75
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 99.69
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.52
d1a8ya3119 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.69
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 98.6
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 98.42
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 98.38
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.32
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.31
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.28
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 98.15
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 98.14
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.08
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.06
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 98.03
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.96
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 97.93
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.93
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.9
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 97.88
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 97.88
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 97.85
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.84
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.83
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.82
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.8
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.77
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.74
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 97.72
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 97.72
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.68
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.66
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.65
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.64
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 97.56
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 97.55
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.47
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 97.46
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 97.45
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 97.4
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.4
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.38
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.31
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.24
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 97.24
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.16
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 97.15
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 97.08
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 97.0
d2b5ea298 Protein disulfide isomerase, PDI {Baker's yeast (S 96.97
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 96.93
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 96.92
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 96.87
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 96.73
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 96.64
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 96.59
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 96.53
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 96.45
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 96.27
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.13
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 96.06
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 96.04
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 95.85
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 95.77
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 95.42
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 95.39
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 95.36
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 95.1
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 95.03
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 94.91
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 91.73
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 91.7
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 87.94
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 87.34
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 86.81
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 85.56
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 84.84
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 82.92
d1wjka_100 Thioredoxin-like structure containing protein C330 81.18
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 80.84
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: PDI-like
domain: Protein disulfide isomerase, PDI
species: Fungi (Humicola insolens) [TaxId: 34413]
Probab=99.89  E-value=6.4e-23  Score=165.00  Aligned_cols=123  Identities=20%  Similarity=0.267  Sum_probs=108.4

Q ss_pred             cCCCeeecChhhHHHhhcCCCcEEEEEEeCCChhHHHHHHHHHHHHHHhCCC-eEEEEEcCcchhhHhhhcCCcCCCCCC
Q 020623          127 FLPLSVPINQDTLNLLKDDKRKIVLAIVEDETEEKSQKLVTTLKAAASANRE-LVFCYVGIKQFADFADTFEANKKSKLP  205 (323)
Q Consensus       127 ~~Plv~~~t~~~~~~~~~~~~~~v~~f~~~~~~e~~~~~~~~l~~~A~~~~~-l~F~~vd~~~~~~~~~~~gl~~~~~~P  205 (323)
                      .+|+|+++|.+|+..|+..++|++++|++.  .++.+++.+.|+++|++|++ ++|+|+|++++++.+++||+ +..++|
T Consensus         4 ~lPLv~e~~~~n~~~~~~~~~pl~~lf~~~--~~~~~~~~~~~~~vA~~~~~ki~Fv~vd~~~~~~~l~~~gl-~~~~~P   80 (133)
T d2djka1           4 GSPLIGEIGPETYSDYMSAGIPLAYIFAET--AEERKELSDKLKPIAEAQRGVINFGTIDAKAFGAHAGNLNL-KTDKFP   80 (133)
T ss_dssp             SCCCSEECCHHHHHHHHHTTSCEEEEECSC--SSSHHHHHHHHHHHHHSSTTTSEEEEECTTTTGGGTTTTTC-CSSSSS
T ss_pred             CCCceeccChhhHHHHhcCCCCEEEEEeCC--chHHHHHHHHHHHHHHHhcCceEEEEEeHHHhHHHHHHhcC-CcccCC
Confidence            589999999999999999999999988764  34568899999999999999 99999999999999999999 789999


Q ss_pred             eEEEEeCCc--ceeeccCCCCCCCCCCHHHHHHHHHHHHcCcccccccCC--CCCC
Q 020623          206 KMVVWDGNE--NYLTVIGSESIDEEDQGSQISRFLEGYREGRTEQKKVAG--PSIF  257 (323)
Q Consensus       206 ~ivI~~~~~--kY~~~~~~~~~~~~~t~~~I~~Fi~~~~~Gkl~~~~kSe--P~~~  257 (323)
                      +++|++.++  +|.+..     +.+++.++|.+||++|++|+++|++|||  |+.|
T Consensus        81 ~~~i~~~~~~~~~~~~~-----~~~i~~~~i~~Fi~d~~~Gkl~p~~kSe~iPe~~  131 (133)
T d2djka1          81 AFAIQEVAKNQKFPFDQ-----EKEITFEAIKAFVDDFVAGKIEPSIKSEPIPEKQ  131 (133)
T ss_dssp             EEEEECTTTCCBCCCCS-----SSCCCHHHHHHHHHHHHHTCCCCSSCCCCCCTTS
T ss_pred             cEEEEEcCCCceecCCc-----cccCCHHHHHHHHHHHHcCCCCcccccCCCCCCC
Confidence            999999743  555432     4568999999999999999999999999  7665



>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b5ea2 c.47.1.2 (A:142-239) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure