Citrus Sinensis ID: 020637


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCKHFLHSLGKEL
ccccccccccccccccccccEEEEEEEcccccEEEEEEcccccccccccccccccccEEEEEEEcccCEEEEEEEEccEEECcccccCCcccccCEEEEEEccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHcccccccccccccccEEEEEcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccHHHHHHHHHHcccCEEEEECccccccccccEEEEEEHHHHHHHHHHHHHHcccc
*************GVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGN*RPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCKHFLHSLGKE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYNSGLNTGHENSGVVGSILVPVRFIWPNGGRRVSLSGSFTRWSEPMPMSPSEGCPAVFQIICRLPPGHHQYKFYVDGEWRHDENQPHVSGNYGVVNCVYIAVPQPDMVPNTISPETSGNMEVDDVVMRPEGFAQYSEADLQLSRDRISSFLSTHTVYELLPDSGKVTALDVNLAVKQAFHVLYEQGLPMVPLWDDFKGRFVGVLSALDFILILRELGTNGSNLTEEELETHTISAWKVGKLQLNLKRQMDGNGRPCPRPLVQAGPYDSLKEVALKILQNKVATVPIIHSTGPAGSCQEILYLASLSDILKCKHFLHSLGKEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sucrose nonfermenting 4-like protein Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.probableQ944A6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T4N, chain C
Confidence level:very confident
Coverage over the Query: 141-244,255-312
View the alignment between query and template
View the model in PyMOL
Template: 2QLV, chain B
Confidence level:very confident
Coverage over the Query: 19-105
View the alignment between query and template
View the model in PyMOL