Citrus Sinensis ID: 020673

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---

MREPSMMVRETAAEQLEERQSDWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRRSRRRVSAFGGAEEGNLNSGTTRGDSGEYVSLANQLEEEGTSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVADQEGASKEDIERLSKFKFRRMVDTEKLSDDGQGSQGGIMTECGTETPNEHVLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNILKSSSNQDREEV

cccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHEEEEEEEEEcccccccccccccccccccccccccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccHHHHHccccccccccccccccccccccccc

*********************DWAYSKPVVVLDIIWNLAFVAVAFSVMVLSQNERPNMPLRLWIVGYAIQCVLHMVCVCVEYKRR***************************************TSVAKHLESANTMFSFIWWIIGFYWVSAGGQALARDSPLLYWLCIIFLGFDVFFVVFCVALACIIGIAVCCCLPCIIAILYAVAD**********RLSKFKFRRM*****************************VLSNEDAECCICLSAYDDGVELRELPCGHHFHCACVDKWLYINATCPLCKYNIL***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase At1g12760	Mediates E2-dependent protein ubiquitination in vitro.	probable	Q9LN71
E3 ubiquitin-protein ligase At1g63170	Mediates E2-dependent protein ubiquitination.	probable	Q8LDB8

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 209-232,261-313
View the alignment between query and template
View the model in PyMOL

Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 256-311
View the alignment between query and template
View the model in PyMOL