Citrus Sinensis ID: 020711

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--

MGSGETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRGIALAESQSDEFDRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSEVCLKCTNLIMQ

cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***********AAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERISSRVASRG***************************************SAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNL**********************************SESDKGGWVLDSTSTSEVCLKCTNLIMQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peroxisome biogenesis factor 10	Involved in the formation of peroxisomes, lipid bodies and protein bodies. Required for normal-shaped peroxisomes that can physically associate with the outer membrane of the chloroplast envelope. Not involved in beta-oxidation and glyoxylate cycle.	probable	Q9SYU4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!