Citrus Sinensis ID: 020714

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--

MKALRALRTLAPFAEKPNKPRLNPLFIHRFYSAQPQQTDNETENDCDSVFDSSYFRIPTIDDPQNNNAAKKQEPTWDEKYRERTDRIVFGEEAQKGKLRIFQEEEEERKHRALAKALLQAALERQEEEEEEVKEEDQKSVAVGIIGAPNAGKSSIINYMVGTKVAAVSRKTNTTTHEVLGVMTKADTQICIFDTPGLMLNKSGYSHKDVKVRVESAWSAVNLFEVLMVVFDVHRHLTSPDSRVIRLIERMGKQAPPKQKRVLCMNKVDLVTKKKDLLKVAEQFKHLPGYERIFMTSGLKGAGLKALTQYLMEQFKDLGLKIH

cHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccHccccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccccccEEEEEEEEccccccHHHHHHHHHccEEcEEccccccccccccEEEEcccEEEEEEccccccccccccccHHHHHHHHHHHHHcccccEEEEEEEccccccccHHHHHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHHHccccccCEEEccccccccHHHHHHHHHHHccccccccc

******L****************PLFIHRFY******************FDSSYFRIPT********************************************************************************VAVGIIGAPNAGKSSIINYMVGTKVAAVSRKTNTTTHEVLGVMTKADTQICIFDTPGLMLNKSGYSHKDVKVRVESAWSAVNLFEVLMVVFDVHRHLTSPDSRVIRLIERMGKQAPPKQKRVLCMNKVDLVTKKKDLLKVAEQFKHLPGYERIFMTSGLKGAGLKALTQYLMEQFKDLGLKIH

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKALRALRTLAPFAEKPNKPRLNPLFIHRFYSAQPQQTDNETENDCDSVFDSSYFRIPTIDDPQNNNAAKKQEPTWDEKYRERTDRIVFGEEAQKGKLRIFQEEEEERKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSVAVGIIGAPNAGKSSIINYMVGTKVAAVSRKTNTTTHEVLGVMTKADTQICIFDTPGLMLNKSGYSHKDVKVRVESAWSAVNLFEVLMVVFDVHRHLTSPDSRVIRLIERMGKQAPPKQKRVLCMNKVDLVTKKKDLLKVAEQFKHLPGYERIFMTSGLKGAGLKALTQYLMEQFKDLGLKIH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
GTP-binding protein ERG	Has a crucial role in plant growth and development, possibly by influencing mitochondrial division.	probable	O82653

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HJG, chain A
Confidence level:very confident
Coverage over the Query: 45-104,118-319
View the alignment between query and template
View the model in PyMOL

Template: 1PUJ, chain A
Confidence level:very confident
Coverage over the Query: 29-103,114-165,178-201
View the alignment between query and template
View the model in PyMOL