Citrus Sinensis ID: 020735


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MAVMLRCSSILTRPSSVRSPPPDHFSDKTHVSGKLASLLHKLEKFASSFTNASSSSRARHLRFGRCLESEGSRGIGKMQQLCDILLEGLPAHQQGKVQLRSTTTTFLVVNTLMLTTPFKALAETCEADNSFFNMPLLLFVALIGATVGGLLARQRRGELQRVNEQLRQINAALRRQAKIESYAPSLSYAPVGSRIPEDEVIVDPKKEELLSRLKTGKNFLRNQDLEKAFTEFKAALELAQNVKDPIEEKKAARGLGASLQRQGKYREAIKYHSMVLQISEREGEYSGSTEAYGAIADCYTELGDLERAARFYDKYISRLESD
cccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc
*AVM***S**************************LASLLHKLEKFASSFT************FGRCL*****RGIGKMQQLCDILLEGLPAHQQGKVQLRSTTTTFLVVNTLMLTTPFKALAETCEADNSFFNMPLLLFVALIGATVGGLLARQRRGELQRVNEQLRQINAALRRQAKIESYAPSLSYAPVGSRIPED**IVDPKKEELLSRLKTGKNFLRNQDLEKAFTEFKAALELAQNVKDPIEEKKAARGLGASLQRQGKYREAIKYHSMVLQISEREGEYSGSTEAYGAIADCYTELGDLERAARFYDKYISRL***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVMLRCSSILTRPSSVRSPPPDHFSDKTHVSGKLASLLHKLEKFASSFTNASSSSRARHLRFGRCLESEGSRGIGKMQQLCDILLEGLPAHQQGKVQLRSTTTTFLVVNTLMLTTPFKALAETCEADNSFFNMPLLLFVALIGATVGGLLARQRxxxxxxxxxxxxxxxxxxxxxxxxESYAPSLSYAPVGSRIPEDEVIVDPKKEELLSRLKTGKNFLRxxxxxxxxxxxxxxxxxxxxxKDPIEEKKAARGLGASLQRQGKYREAIKYHSMVLQISEREGEYSGSTEAYGAIADCYTELGDLERAARFYDKYISRLESD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein FLUORESCENT IN BLUE LIGHT, chloroplastic Negative regulator of tetrapyrrole biosynthesis (including chlorophyll) in chloroplasts, probably via HEMA1 repression. Inhibits especially the magnesium ion Mg(2+) branch of tetrapyrrole biosynthesis, but independently of heme.probableQ940U6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 174-191,208-321
View the alignment between query and template
View the model in PyMOL
Template: 3ULQ, chain A
Confidence level:very confident
Coverage over the Query: 171-191,202-320
View the alignment between query and template
View the model in PyMOL
Template: 2IF4, chain A
Confidence level:confident
Coverage over the Query: 161-277
View the alignment between query and template
View the model in PyMOL