Citrus Sinensis ID: 020737


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MAPATTSSAEARRLIGSRRRTEAPRRMLSPSPPPKKVKSMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVVYDSCEGFTVEADGQIKDMTFIAEYIGDVDFIRNREHDDCDSMMTLLLATDPSKSLVICPDKRGNIARFINGINNYTP
ccccccccHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHccccccEEEEcccccccccccccHHHHHHHHcccHHHHHHHHHHHHcccccccccccccccccHHHccccccccccccHHHHHHHHHHHHccccccEEEEECccccEEEEEcccccccEEEEEEccccEEEEcccccccccHHHHcccccccccEEEcccccccHHHHHcccccccc
******************************************ILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIK************************************************************QMEFSDDLTYMPGMAPRS**********************EQCRAMCKRGECPPLVVVYDSCEGFTVEADGQIKDMTFIAEYIGDVDFIRNREHDDCDSMMTLLLATDPSKSLVICPDKRGNIARFINGIN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPATTSSAEARRLIGSRRRTEAPRRMLSPSPPPKKVKSMEEILAKAHYAVVERGDYGDVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVVYDSCEGFTVEADGQIKDMTFIAEYIGDVDFIRNREHDDCDSMMTLLLATDPSKSLVICPDKRGNIARFINGINNYTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.43Histone-lysine N-methyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YSM, chain A
Confidence level:very confident
Coverage over the Query: 60-110
View the alignment between query and template
View the model in PyMOL
Template: 3OPE, chain A
Confidence level:very confident
Coverage over the Query: 200-315
View the alignment between query and template
View the model in PyMOL
Template: 3OOI, chain A
Confidence level:confident
Coverage over the Query: 157-315
View the alignment between query and template
View the model in PyMOL
Template: 3U5M, chain A
Confidence level:probable
Coverage over the Query: 63-108,126-136,148-164
View the alignment between query and template
View the model in PyMOL