Citrus Sinensis ID: 020737
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 322 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VZJ1 | 352 | Histone-lysine N-methyltr | no | no | 0.863 | 0.789 | 0.636 | 1e-107 | |
| Q9FNE9 | 349 | Histone-lysine N-methyltr | no | no | 0.807 | 0.744 | 0.606 | 2e-86 | |
| A6H619 | 1682 | PHD and RING finger domai | yes | no | 0.142 | 0.027 | 0.521 | 2e-10 | |
| Q63625 | 1685 | PHD and RING finger domai | yes | no | 0.142 | 0.027 | 0.521 | 2e-10 | |
| Q9P1Y6 | 1649 | PHD and RING finger domai | yes | no | 0.145 | 0.028 | 0.510 | 2e-10 | |
| Q9DE13 | 2130 | Bromodomain adjacent to z | yes | no | 0.350 | 0.053 | 0.350 | 4e-09 | |
| Q8BZ21 | 2003 | Histone acetyltransferase | no | no | 0.186 | 0.029 | 0.390 | 5e-09 | |
| Q9UIF8 | 2168 | Bromodomain adjacent to z | no | no | 0.369 | 0.054 | 0.333 | 6e-09 | |
| Q5TKR9 | 1998 | Histone acetyltransferase | yes | no | 0.186 | 0.030 | 0.390 | 6e-09 | |
| Q92794 | 2004 | Histone acetyltransferase | no | no | 0.186 | 0.029 | 0.390 | 6e-09 |
| >sp|Q8VZJ1|ATXR5_ARATH Histone-lysine N-methyltransferase ATXR5 OS=Arabidopsis thaliana GN=ATXR5 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 388 bits (997), Expect = e-107, Method: Compositional matrix adjust.
Identities = 198/311 (63%), Positives = 237/311 (76%), Gaps = 33/311 (10%)
Query: 18 RRRTEAP-RRMLSPSPPPKKVKSMEEILAKAHYAVVERG-----DYGDVGCEQCGSGERA 71
RRRT+AP RR S SPPP+K+KSM EI+AK+ V + Y +V CE+CGSGE
Sbjct: 17 RRRTKAPARRPSSESPPPRKMKSMAEIMAKSVPVVEQEEEEDEDSYSNVTCEKCGSGEGD 76
Query: 72 EELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRKIIDFFKIKKPNL 131
+ELLLCDKCD+GFHMKCLRPIVVRVPIGTWLC CS QR VR
Sbjct: 77 DELLLCDKCDRGFHMKCLRPIVVRVPIGTWLCVDCSDQRPVR------------------ 118
Query: 132 TEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGSLAHALTALQMEF 191
++TRKRRR S SL ++K+RR+LLP PSED QRL+QMG+LA ALTAL +++
Sbjct: 119 --------KETRKRRR-SCSLTVKKRRRKLLPLVPSEDPDQRLAQMGTLASALTALGIKY 169
Query: 192 SDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVVYDSCEG 251
SD L Y+PGMAPRSANQ++ E+GGMQVL KED ETLEQC++M +RGECPPLVVV+D EG
Sbjct: 170 SDGLNYVPGMAPRSANQSKLEKGGMQVLCKEDLETLEQCQSMYRRGECPPLVVVFDPLEG 229
Query: 252 FTVEADGQIKDMTFIAEYIGDVDFIRNREHDDCDSMMTLLLATDPSKSLVICPDKRGNIA 311
+TVEADG IKD+TFIAEY GDVD+++NRE DDCDS+MTLLL+ DPSK+LVICPDK GNI+
Sbjct: 230 YTVEADGPIKDLTFIAEYTGDVDYLKNREKDDCDSIMTLLLSEDPSKTLVICPDKFGNIS 289
Query: 312 RFINGINNYTP 322
RFINGINN+ P
Sbjct: 290 RFINGINNHNP 300
|
Histone methyltransferase. Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3 |
| >sp|Q9FNE9|ATXR6_ARATH Histone-lysine N-methyltransferase ATXR6 OS=Arabidopsis thaliana GN=ATXR6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A6H619|PHRF1_MOUSE PHD and RING finger domain-containing protein 1 OS=Mus musculus GN=Phrf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q63625|PHRF1_RAT PHD and RING finger domain-containing protein 1 OS=Rattus norvegicus GN=Phrf1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9P1Y6|PHRF1_HUMAN PHD and RING finger domain-containing protein 1 OS=Homo sapiens GN=PHRF1 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8BZ21|KAT6A_MOUSE Histone acetyltransferase KAT6A OS=Mus musculus GN=Kat6a PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q5TKR9|KAT6A_RAT Histone acetyltransferase KAT6A OS=Rattus norvegicus GN=Kat6a PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q92794|KAT6A_HUMAN Histone acetyltransferase KAT6A OS=Homo sapiens GN=KAT6A PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 322 | ||||||
| 255552380 | 374 | Histone-lysine N-methyltransferase ATXR6 | 0.990 | 0.852 | 0.804 | 1e-143 | |
| 225431531 | 374 | PREDICTED: histone-lysine N-methyltransf | 0.940 | 0.810 | 0.771 | 1e-135 | |
| 449511173 | 378 | PREDICTED: histone-lysine N-methyltransf | 1.0 | 0.851 | 0.739 | 1e-131 | |
| 449459284 | 385 | PREDICTED: histone-lysine N-methyltransf | 0.953 | 0.797 | 0.755 | 1e-131 | |
| 356508991 | 375 | PREDICTED: histone-lysine N-methyltransf | 0.996 | 0.856 | 0.677 | 1e-123 | |
| 356516345 | 375 | PREDICTED: histone-lysine N-methyltransf | 0.996 | 0.856 | 0.673 | 1e-121 | |
| 224131178 | 333 | SET domain protein [Populus trichocarpa] | 0.810 | 0.783 | 0.729 | 1e-115 | |
| 9759010 | 378 | unnamed protein product [Arabidopsis tha | 0.944 | 0.804 | 0.668 | 1e-115 | |
| 71388893 | 379 | ATXR5 [Arabidopsis thaliana] | 0.947 | 0.804 | 0.659 | 1e-115 | |
| 145334355 | 379 | histone-lysine N-methyltransferase ATXR5 | 0.947 | 0.804 | 0.659 | 1e-115 |
| >gi|255552380|ref|XP_002517234.1| Histone-lysine N-methyltransferase ATXR6, putative [Ricinus communis] gi|223543605|gb|EEF45134.1| Histone-lysine N-methyltransferase ATXR6, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 515 bits (1326), Expect = e-143, Method: Compositional matrix adjust.
Identities = 260/323 (80%), Positives = 282/323 (87%), Gaps = 4/323 (1%)
Query: 1 MAPA--TTSSAEARRLIGSRRRTEAPRRMLSPSPPPKKVKSMEEILAKAHYAVVERGDYG 58
MAPA TT++ ARR++GSRRRT+A SPPPKK+K + EILAKA YAVVER DYG
Sbjct: 1 MAPASITTTTTVARRIVGSRRRTKAT--SPPDSPPPKKLKPISEILAKAQYAVVERADYG 58
Query: 59 DVGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQR 118
DV C QCGSGERAEELLLCDKCDKGFHMKC+RPIVVRVPIG+WLCPKCSGQRRVR SQR
Sbjct: 59 DVSCMQCGSGERAEELLLCDKCDKGFHMKCVRPIVVRVPIGSWLCPKCSGQRRVRRLSQR 118
Query: 119 KIIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMG 178
KIIDFF+I+K N +KC SPQD RK RRRS SLV QK+RRRLLPF SED +QRL QMG
Sbjct: 119 KIIDFFRIQKCNHKTDKCSSPQDIRKHRRRSGSLVYQKRRRRLLPFVSSEDPAQRLKQMG 178
Query: 179 SLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGE 238
+LA ALT LQMEFSDDLTY GMAPRSANQA FEEGGMQVL+KED ETLEQCRAMCKRG+
Sbjct: 179 TLASALTELQMEFSDDLTYSSGMAPRSANQARFEEGGMQVLTKEDIETLEQCRAMCKRGD 238
Query: 239 CPPLVVVYDSCEGFTVEADGQIKDMTFIAEYIGDVDFIRNREHDDCDSMMTLLLATDPSK 298
CPPL+VV+DS EGFTVEADGQIKDMTFIAEY GDVD+IRNREHDDCDSMMTLLLA DPSK
Sbjct: 239 CPPLLVVFDSREGFTVEADGQIKDMTFIAEYTGDVDYIRNREHDDCDSMMTLLLAKDPSK 298
Query: 299 SLVICPDKRGNIARFINGINNYT 321
SLVICPDKRGNIARFI+GINN+T
Sbjct: 299 SLVICPDKRGNIARFISGINNHT 321
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225431531|ref|XP_002281774.1| PREDICTED: histone-lysine N-methyltransferase ATXR5 [Vitis vinifera] gi|296088576|emb|CBI37567.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449511173|ref|XP_004163884.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449459284|ref|XP_004147376.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356508991|ref|XP_003523236.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356516345|ref|XP_003526856.1| PREDICTED: histone-lysine N-methyltransferase ATXR5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224131178|ref|XP_002328474.1| SET domain protein [Populus trichocarpa] gi|222838189|gb|EEE76554.1| SET domain protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|9759010|dbj|BAB09537.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|71388893|gb|AAZ31374.1| ATXR5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145334355|ref|NP_001078559.1| histone-lysine N-methyltransferase ATXR5 [Arabidopsis thaliana] gi|7671410|emb|CAB89351.1| putative protein [Arabidopsis thaliana] gi|332004064|gb|AED91447.1| histone-lysine N-methyltransferase ATXR5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 322 | ||||||
| TAIR|locus:2144841 | 379 | ATXR5 "AT5G09790" [Arabidopsis | 0.978 | 0.831 | 0.625 | 5.3e-104 | |
| TAIR|locus:2169779 | 349 | ATXR6 "AT5G24330" [Arabidopsis | 0.816 | 0.753 | 0.602 | 3.6e-82 | |
| ZFIN|ZDB-GENE-041010-202 | 1305 | baz2a "bromodomain adjacent to | 0.593 | 0.146 | 0.282 | 4e-12 | |
| ZFIN|ZDB-GENE-030131-624 | 1670 | phrf1 "PHD and ring finger dom | 0.453 | 0.087 | 0.284 | 1.5e-09 | |
| UNIPROTKB|F1NRS9 | 1981 | BAZ2B "Bromodomain adjacent to | 0.400 | 0.065 | 0.340 | 3.9e-09 | |
| UNIPROTKB|F1P2F7 | 2125 | BAZ2B "Bromodomain adjacent to | 0.400 | 0.060 | 0.340 | 4.2e-09 | |
| UNIPROTKB|E1C3I8 | 2126 | BAZ2B "Bromodomain adjacent to | 0.400 | 0.060 | 0.340 | 4.2e-09 | |
| UNIPROTKB|Q9DE13 | 2130 | BAZ2B "Bromodomain adjacent to | 0.400 | 0.060 | 0.340 | 4.2e-09 | |
| UNIPROTKB|H0YDG9 | 276 | RSF1 "Remodeling and spacing f | 0.139 | 0.163 | 0.488 | 8.6e-09 | |
| UNIPROTKB|I3LU11 | 1643 | PHRF1 "Uncharacterized protein | 0.142 | 0.027 | 0.521 | 1.1e-08 |
| TAIR|locus:2144841 ATXR5 "AT5G09790" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1030 (367.6 bits), Expect = 5.3e-104, P = 5.3e-104
Identities = 202/323 (62%), Positives = 249/323 (77%)
Query: 7 SSAEARRLIGSRRRTEAP-RRMLXXXXXXXXXXXMEEILAKAHYAVVERGD------YGD 59
+S+ A SRRRT+AP RR M EI+AK+ VVE+ + Y +
Sbjct: 6 ASSPAASPCSSRRRTKAPARRPSSESPPPRKMKSMAEIMAKS-VPVVEQEEEEDEDSYSN 64
Query: 60 VGCEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCSGQRRVRSFSQRK 119
V CE+CGSGE +ELLLCDKCD+GFHMKCLRPIVVRVPIGTWLC CS QR VR SQ+K
Sbjct: 65 VTCEKCGSGEGDDELLLCDKCDRGFHMKCLRPIVVRVPIGTWLCVDCSDQRPVRRLSQKK 124
Query: 120 IIDFFKIKKPNLTEEKCDSPQDTRKRRRRSASLVLQKKRRRLLPFTPSEDRSQRLSQMGS 179
I+ FF+I+K +K + Q+ ++RRRS SL ++K+RR+LLP PSED QRL+QMG+
Sbjct: 125 ILHFFRIEKHTHQTDKLELSQEETRKRRRSCSLTVKKRRRKLLPLVPSEDPDQRLAQMGT 184
Query: 180 LAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGEC 239
LA ALTAL +++SD L Y+PGMAPRSANQ++ E+GGMQVL KED ETLEQC++M +RGEC
Sbjct: 185 LASALTALGIKYSDGLNYVPGMAPRSANQSKLEKGGMQVLCKEDLETLEQCQSMYRRGEC 244
Query: 240 PPLVVVYDSCEGFTVEADGQIKDMTFIAEYIGDVDFIRNREHDDCDSMMTLLLATDPSKS 299
PPLVVV+D EG+TVEADG IKD+TFIAEY GDVD+++NRE DDCDS+MTLLL+ DPSK+
Sbjct: 245 PPLVVVFDPLEGYTVEADGPIKDLTFIAEYTGDVDYLKNREKDDCDSIMTLLLSEDPSKT 304
Query: 300 LVICPDKRGNIARFINGINNYTP 322
LVICPDK GNI+RFINGINN+ P
Sbjct: 305 LVICPDKFGNISRFINGINNHNP 327
|
|
| TAIR|locus:2169779 ATXR6 "AT5G24330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041010-202 baz2a "bromodomain adjacent to zinc finger domain, 2A" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-624 phrf1 "PHD and ring finger domains 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRS9 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P2F7 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C3I8 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9DE13 BAZ2B "Bromodomain adjacent to zinc finger domain protein 2B" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YDG9 RSF1 "Remodeling and spacing factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LU11 PHRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.1.43 | 0.946 |
| 3rd Layer | 2.1.1 | 0.963 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00034847001 | SubName- Full=Chromosome chr4 scaffold_73, whole genome shotgun sequence; (374 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 322 | |||
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 8e-10 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 5e-09 | |
| cd04718 | 148 | cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homol | 5e-05 |
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
Score = 53.6 bits (129), Expect = 8e-10
Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
Query: 62 CEQCGSGERAEELLLCDKCDKGFHMKCLRP--IVVRVPIGTWLCPKCS 107
C CG + ELLLCD CD+ FH+ CL P +P G W CP+C
Sbjct: 2 CAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCPECK 49
|
PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51 |
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|240069 cd04718, BAH_plant_2, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 322 | |||
| KOG1083 | 1306 | consensus Putative transcription factor ASH1/LIN-5 | 99.9 | |
| KOG4442 | 729 | consensus Clathrin coat binding protein/Huntingtin | 99.78 | |
| KOG1082 | 364 | consensus Histone H3 (Lys9) methyltransferase SUV3 | 99.72 | |
| KOG1080 | 1005 | consensus Histone H3 (Lys4) methyltransferase comp | 99.31 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 99.17 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 99.08 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 99.07 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 99.04 | |
| KOG1079 | 739 | consensus Transcriptional repressor EZH1 [Transcri | 98.9 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 98.83 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 98.81 | |
| smart00317 | 116 | SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) | 98.8 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.79 | |
| KOG1085 | 392 | consensus Predicted methyltransferase (contains a | 98.65 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 98.59 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 98.42 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 98.11 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 98.07 | |
| KOG1246 | 904 | consensus DNA-binding protein jumonji/RBP2/SMCY, c | 98.06 | |
| KOG1141 | 1262 | consensus Predicted histone methyl transferase [Ch | 98.06 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 98.06 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 98.05 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 98.04 | |
| KOG0956 | 900 | consensus PHD finger protein AF10 [General functio | 97.96 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 97.85 | |
| KOG1141 | 1262 | consensus Predicted histone methyl transferase [Ch | 97.84 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 97.72 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 97.68 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 97.67 | |
| COG2940 | 480 | Proteins containing SET domain [General function p | 97.55 | |
| KOG1081 | 463 | consensus Transcription factor NSD1 and related SE | 96.39 | |
| KOG1473 | 1414 | consensus Nucleosome remodeling factor, subunit NU | 95.87 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 94.46 | |
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 91.81 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.69 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 91.15 | |
| KOG1632 | 345 | consensus Uncharacterized PHD Zn-finger protein [G | 90.05 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 89.71 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 89.23 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 88.86 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 88.77 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 88.08 | |
| KOG1844 | 508 | consensus PHD Zn-finger proteins [General function | 85.57 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 85.1 | |
| PF00856 | 162 | SET: SET domain; InterPro: IPR001214 The SET domai | 84.61 |
| >KOG1083 consensus Putative transcription factor ASH1/LIN-59 [Transcription] | Back alignment and domain information |
|---|
Probab=99.90 E-value=1.9e-24 Score=222.56 Aligned_cols=129 Identities=28% Similarity=0.280 Sum_probs=119.8
Q ss_pred hhhhhhhhhhhhhhhccCccCCCCCCCCCCCCccccChhhhhccCccccChhhhHHHHHHHHHHHhCCCCCeEEEEeCCC
Q 020737 171 SQRLSQMGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAMCKRGECPPLVVVYDSCE 250 (322)
Q Consensus 171 ~~~le~~asl~tal~~~g~~fs~~l~y~pg~a~~~~N~~~~e~~~~~v~~~ed~~~~~~~~r~~q~g~~~~l~v~~~~~k 250 (322)
..|+.++++|+.++.+.+..++..+.|.+|+++..+ .|. .+|+||..+|.+++|+||+++.+
T Consensus 1127 k~R~~~~~dL~~~~~A~n~~~~c~kg~~~g~~~cld---------------~d~---c~nqrm~r~e~cp~L~v~~gp~~ 1188 (1306)
T KOG1083|consen 1127 KIRINVYKDLQRLSKAGNNTCKCRKGRPRKQKTCLD---------------PDS---CSNQRMQRHEECPPLEVFRGPKK 1188 (1306)
T ss_pred HHHHHHHHhhhhhhhccCccccccCCCCCCCccccC---------------chh---hhhHHhhhhccCCCcceeccCCC
Confidence 899999999999999999999999999999977766 222 56799999999999999999999
Q ss_pred ceeeeecccCCCCceeEEeeeeehhhhhhhccCCCceeeeeccCCCCCcEEEcCCCCCCeeeeccCCCCCC
Q 020737 251 GFTVEADGQIKDMTFIAEYIGDVDFIRNREHDDCDSMMTLLLATDPSKSLVICPDKRGNIARFINGINNYT 321 (322)
Q Consensus 251 G~gv~a~~~I~~g~fv~EY~Gev~~~~~~~~~~~~~~~~~~~~~~~~~~~vIda~~~GNiaRFiN~~~~~~ 321 (322)
||||+|+++|++|||||||||||+++++++.+ ||+++...++...|+|||+.++|+.||+||||||.
T Consensus 1189 G~~v~tk~PikagtfI~EYvGeVit~ke~e~~----mmtl~~~d~~~~cL~I~p~l~id~~R~~n~~Rfin 1255 (1306)
T KOG1083|consen 1189 GWGVRTKEPIKAGTFIMEYVGEVITEKEFEPR----MMTLYHNDDDHYCLVIDPGLFIDIPRMGNGARFIN 1255 (1306)
T ss_pred CccccccccccccchHHHHHHHHHHHHhhccc----ccccCCCCCcccccccCccccCChhhccccccccc
Confidence 99999999999999999999999999998866 89999888888999999999999999999999984
|
|
| >KOG4442 consensus Clathrin coat binding protein/Huntingtin interacting protein HIP1, involved in regulation of endocytosis [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1082 consensus Histone H3 (Lys9) methyltransferase SUV39H1/Clr4, required for transcriptional silencing [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1080 consensus Histone H3 (Lys4) methyltransferase complex, subunit SET1 and related methyltransferases [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1079 consensus Transcriptional repressor EZH1 [Transcription] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00317 SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG1085 consensus Predicted methyltransferase (contains a SET domain) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1246 consensus DNA-binding protein jumonji/RBP2/SMCY, contains JmjC domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1141 consensus Predicted histone methyl transferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0956 consensus PHD finger protein AF10 [General function prediction only] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1141 consensus Predicted histone methyl transferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG2940 Proteins containing SET domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1844 consensus PHD Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF00856 SET: SET domain; InterPro: IPR001214 The SET domain appears generally as one part of a larger multidomain protein, and recently there were described three structures of very different proteins with distinct domain compositions: Neurospora crassa DIM-5, a member of the Su(var) family of HKMTs which methylate histone H3 on lysine 9,human SET7 (also called SET9), which methylates H3 on lysine 4 and garden pea Rubisco LSMT, an enzyme that does not modify histones, but instead methylates lysine 14 in the flexible tail of the large subunit of the enzyme Rubisco | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 322 | ||||
| 2kwj_A | 114 | Solution Structures Of The Double Phd Fingers Of Hu | 2e-07 | ||
| 2e6r_A | 92 | Solution Structure Of The Phd Domain In Smcy Protei | 4e-07 | ||
| 3v43_A | 112 | Crystal Structure Of Moz Length = 112 | 4e-07 | ||
| 2ln0_A | 110 | Structure Of Moz Length = 110 | 4e-07 | ||
| 1f62_A | 51 | Wstf-Phd Length = 51 | 9e-07 | ||
| 1mm2_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 6e-06 | ||
| 2puy_A | 60 | Crystal Structure Of The Bhc80 Phd Finger Length = | 1e-05 | ||
| 3ask_A | 226 | Structure Of Uhrf1 In Complex With Histone Tail Len | 1e-05 | ||
| 4gy5_A | 241 | Crystal Structure Of The Tandem Tudor Domain And Pl | 1e-05 | ||
| 2ysm_A | 111 | Solution Structure Of The First And Second Phd Doma | 2e-05 | ||
| 2yql_A | 56 | Solution Structure Of The Phd Domain In Phd Finger | 2e-05 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 2e-05 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 2e-05 | ||
| 1mm3_A | 61 | Solution Structure Of The 2nd Phd Domain From Mi2b | 2e-05 | ||
| 2l5u_A | 61 | Structure Of The First Phd Finger (Phd1) From Chd4 | 6e-05 | ||
| 3zvz_B | 57 | Phd Finger Of Human Uhrf1 Length = 57 | 1e-04 | ||
| 1xwh_A | 66 | Nmr Structure Of The First Phd Finger Of Autoimmune | 1e-04 | ||
| 3sou_A | 70 | Structure Of Uhrf1 Phd Finger In Complex With Histo | 2e-04 | ||
| 3zvy_A | 72 | Phd Finger Of Human Uhrf1 In Complex With Unmodifie | 2e-04 | ||
| 2kft_A | 56 | Nmr Solution Structure Of The First Phd Finger Doma | 2e-04 | ||
| 3shb_A | 77 | Crystal Structure Of Phd Domain Of Uhrf1 Length = 7 | 2e-04 | ||
| 2lgg_A | 69 | Structure Of Phd Domain Of Uhrf1 In Complex With H3 | 2e-04 | ||
| 3t6r_A | 72 | Structure Of Uhrf1 In Complex With Unmodified H3 N- | 3e-04 | ||
| 2e6s_A | 77 | Solution Structure Of The Phd Domain In Ring Finger | 8e-04 |
| >pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 | Back alignment and structure |
|
| >pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 | Back alignment and structure |
| >pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 | Back alignment and structure |
| >pdb|2LN0|A Chain A, Structure Of Moz Length = 110 | Back alignment and structure |
| >pdb|1F62|A Chain A, Wstf-Phd Length = 51 | Back alignment and structure |
| >pdb|1MM2|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b Length = 61 | Back alignment and structure |
| >pdb|2PUY|A Chain A, Crystal Structure Of The Bhc80 Phd Finger Length = 60 | Back alignment and structure |
| >pdb|3ASK|A Chain A, Structure Of Uhrf1 In Complex With Histone Tail Length = 226 | Back alignment and structure |
| >pdb|4GY5|A Chain A, Crystal Structure Of The Tandem Tudor Domain And Plant Homeodomain Of Uhrf1 With Histone H3k9me3 Length = 241 | Back alignment and structure |
| >pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 | Back alignment and structure |
| >pdb|2YQL|A Chain A, Solution Structure Of The Phd Domain In Phd Finger Protein 21a Length = 56 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|1MM3|A Chain A, Solution Structure Of The 2nd Phd Domain From Mi2b With C- Terminal Loop Replaced By Corresponding Loop From Wstf Length = 61 | Back alignment and structure |
| >pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 | Back alignment and structure |
| >pdb|3ZVZ|B Chain B, Phd Finger Of Human Uhrf1 Length = 57 | Back alignment and structure |
| >pdb|1XWH|A Chain A, Nmr Structure Of The First Phd Finger Of Autoimmune Regulator Protein (Aire1): Insights Into Apeced Length = 66 | Back alignment and structure |
| >pdb|3SOU|A Chain A, Structure Of Uhrf1 Phd Finger In Complex With Histone H3 1-9 Peptide Length = 70 | Back alignment and structure |
| >pdb|3ZVY|A Chain A, Phd Finger Of Human Uhrf1 In Complex With Unmodified Histone H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|2KFT|A Chain A, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 56 | Back alignment and structure |
| >pdb|3SHB|A Chain A, Crystal Structure Of Phd Domain Of Uhrf1 Length = 77 | Back alignment and structure |
| >pdb|2LGG|A Chain A, Structure Of Phd Domain Of Uhrf1 In Complex With H3 Peptide Length = 69 | Back alignment and structure |
| >pdb|3T6R|A Chain A, Structure Of Uhrf1 In Complex With Unmodified H3 N-Terminal Tail Length = 72 | Back alignment and structure |
| >pdb|2E6S|A Chain A, Solution Structure Of The Phd Domain In Ring Finger Protein 107 Length = 77 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
Score = 77.8 bits (192), Expect = 7e-19
Identities = 21/46 (45%), Positives = 29/46 (63%)
Query: 62 CEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKCS 107
C+ C ++L+LCD+C+K FH+ CLRP + VP G W CP C
Sbjct: 3 CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQ 48
|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 | Back alignment and structure |
|---|
| >3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens} Length = 290 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A Length = 299 | Back alignment and structure |
|---|
| >3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A* Length = 287 | Back alignment and structure |
|---|
| >1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A* Length = 302 | Back alignment and structure |
|---|
| >2r3a_A Histone-lysine N-methyltransferase SUV39H2; histone H3-K9 methyltransferase 2, H3 lysine-9 specific 2, alternative splicing, cell cycle; HET: SAM; 2.00A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens} Length = 222 | Back alignment and structure |
|---|
| >3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens} Length = 232 | Back alignment and structure |
|---|
| >2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A* Length = 192 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 322 | |||
| 3ooi_A | 232 | Histone-lysine N-methyltransferase, H3 lysine-36 l | 99.79 | |
| 1mvh_A | 299 | Cryptic LOCI regulator 4; lysine methyltransferase | 99.74 | |
| 3ope_A | 222 | Probable histone-lysine N-methyltransferase ASH1L; | 99.73 | |
| 3hna_A | 287 | Histone-lysine N-methyltransferase, H3 lysine-9 sp | 99.73 | |
| 1ml9_A | 302 | Histone H3 methyltransferase DIM-5; adoMet-depende | 99.73 | |
| 3f9x_A | 166 | Histone-lysine N-methyltransferase SETD8; methyltr | 99.72 | |
| 3bo5_A | 290 | Histone-lysine N-methyltransferase setmar; SET dom | 99.72 | |
| 3h6l_A | 278 | Histone-lysine N-methyltransferase SETD2; SET doma | 99.7 | |
| 2r3a_A | 300 | Histone-lysine N-methyltransferase SUV39H2; histon | 99.68 | |
| 2w5y_A | 192 | Histone-lysine N-methyltransferase HRX; transcript | 99.6 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.53 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.53 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.52 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 99.51 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 99.5 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.5 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.49 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 99.47 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 99.47 | |
| 2qpw_A | 149 | PR domain zinc finger protein 2; methyltransferase | 99.43 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.43 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 99.42 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 99.4 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 99.39 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 99.38 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.37 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 99.36 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 99.36 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 99.36 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.32 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 99.29 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 99.28 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 99.26 | |
| 2f69_A | 261 | Histone-lysine N-methyltransferase, H3 lysine-4 sp | 99.25 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 99.25 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 99.24 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 99.22 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 99.22 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 99.21 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.2 | |
| 1n3j_A | 119 | A612L, histone H3 lysine methyltransferase; beta b | 99.2 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 99.2 | |
| 1h3i_A | 293 | Histone H3 lysine 4 specific methyltransferase; 2. | 99.18 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 99.15 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 99.15 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.14 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 99.01 | |
| 3ep0_A | 170 | PR domain zinc finger protein 12; PR domain-contai | 98.98 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 98.97 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 98.96 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.91 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.87 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 98.86 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 98.85 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 98.84 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.83 | |
| 3s8p_A | 273 | Histone-lysine N-methyltransferase SUV420H1; SET d | 98.83 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 98.79 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 98.78 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 98.73 | |
| 3dal_A | 196 | PR domain zinc finger protein 1; methyltransferase | 98.72 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 98.7 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 98.7 | |
| 3db5_A | 151 | PR domain zinc finger protein 4; methyltransferase | 98.63 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.6 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 98.59 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 98.58 | |
| 3rq4_A | 247 | Histone-lysine N-methyltransferase SUV420H2; suppr | 98.55 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.28 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 98.26 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 98.24 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.1 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 98.03 | |
| 3ray_A | 237 | PR domain-containing protein 11; structural genomi | 97.96 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 97.86 | |
| 3ihx_A | 152 | PR domain zinc finger protein 10; PRDM10, methyltr | 97.65 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.63 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 97.07 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 96.86 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 95.89 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 95.55 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 93.61 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 93.6 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 91.63 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 90.33 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 90.2 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 90.1 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 88.82 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 87.84 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 87.38 | |
| 1weq_A | 85 | PHD finger protein 7; structural genomics, PHD dom | 87.14 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 86.18 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 86.05 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 84.36 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 82.67 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 81.66 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 80.77 |
| >3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.79 E-value=5.6e-20 Score=166.94 Aligned_cols=147 Identities=19% Similarity=0.275 Sum_probs=105.4
Q ss_pred HhhhcCCCCCCCcchh--hhhh-hhhhhhhhhccCccCCCCCCCCCCCCccccChhhhhccCccccChhhhHHHHHHHHH
Q 020737 157 KRRRLLPFTPSEDRSQ--RLSQ-MGSLAHALTALQMEFSDDLTYMPGMAPRSANQAEFEEGGMQVLSKEDTETLEQCRAM 233 (322)
Q Consensus 157 ~~r~~lp~vp~~d~~~--~le~-~asl~tal~~~g~~fs~~l~y~pg~a~~~~N~~~~e~~~~~v~~~ed~~~~~~~~r~ 233 (322)
..++..||++...+.. ++.. .+++ +....+....+++..+ |....+.|++...+|+...++-.+.|. +|+
T Consensus 13 ~~~~pp~y~~i~~n~~~~~~~~~~~~~-~~~~~C~C~~~~~~~C--~~~~~C~nr~~~~EC~~~~C~c~~~C~----Nr~ 85 (232)
T 3ooi_A 13 NDKKPPPYKHIKVNRPIGRVQIFTADL-SEIPRCNCKATDENPC--GIDSECINRMLLYECHPTVCPAGGRCQ----NQC 85 (232)
T ss_dssp HCCSCCCCEECSSCEECTTCCCCCCCG-GGSCCCSCCTTSSSTT--CTTSCCHHHHTTBCCCTTTCTTGGGCC----CCH
T ss_pred cCCCCCCceEeeccccccccccccCCc-ccCCcccccCCCCCCC--CCCCCCcCcCceeEeCCCCCCCCCCcC----Ccc
Confidence 3356666765554321 1111 1222 3455677777766666 666789999999999998887766544 466
Q ss_pred HHhCCCCCeEEEEeCCCceeeeecccCCCCceeEEeeeeehhhhhhh--------ccCCCceeeeeccCCCCCcEEEcCC
Q 020737 234 CKRGECPPLVVVYDSCEGFTVEADGQIKDMTFIAEYIGDVDFIRNRE--------HDDCDSMMTLLLATDPSKSLVICPD 305 (322)
Q Consensus 234 ~q~g~~~~l~v~~~~~kG~gv~a~~~I~~g~fv~EY~Gev~~~~~~~--------~~~~~~~~~~~~~~~~~~~~vIda~ 305 (322)
+|+|.+++|+||++..+||||+|.++|++|+||+||+|||+...+.. .+..+.++..+. ..++|||+
T Consensus 86 ~q~~~~~~lev~~t~~kG~Gl~A~~~I~~G~~I~ey~Gevi~~~e~~~r~~~~~~~~~~~~y~~~l~-----~~~~IDa~ 160 (232)
T 3ooi_A 86 FSKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELIDEEECRARIRYAQEHDITNFYMLTLD-----KDRIIDAG 160 (232)
T ss_dssp HHHTCCCCEEEEECSSSSEEEEESSCBCTTCEEEECCEEEECHHHHHHHHHHHHHTTCCCCCEEEEE-----TTEEEEEE
T ss_pred ccCCCCccEEEEEcCCceeEEEECceecCCceeeEeeeeccCHHHHHHHHHHHhhcCCCceeeeecC-----cceEEecc
Confidence 79999999999999999999999999999999999999995433211 122223333332 35899999
Q ss_pred CCCCeeeecc
Q 020737 306 KRGNIARFIN 315 (322)
Q Consensus 306 ~~GNiaRFiN 315 (322)
.+||+|||||
T Consensus 161 ~~Gn~aRfiN 170 (232)
T 3ooi_A 161 PKGNYARFMN 170 (232)
T ss_dssp EEECGGGGCE
T ss_pred cccccccccc
Confidence 9999999997
|
| >1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A | Back alignment and structure |
|---|
| >3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 4h4h_A* 4i51_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A* | Back alignment and structure |
|---|
| >1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A* | Back alignment and structure |
|---|
| >3f9x_A Histone-lysine N-methyltransferase SETD8; methyltransferase, SET, lysine, alternative splicing, cell cycle, cell division, chromatin regulator, chromosomal protein, coiled coil; HET: MLY SAH; 1.25A {Homo sapiens} PDB: 3f9w_A* 3f9y_A* 3f9z_A* 1zkk_A* 4ij8_A* 2bqz_A* | Back alignment and structure |
|---|
| >3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens} | Back alignment and structure |
|---|
| >2r3a_A Histone-lysine N-methyltransferase SUV39H2; histone H3-K9 methyltransferase 2, H3 lysine-9 specific 2, alternative splicing, cell cycle; HET: SAM; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A* | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2qpw_A PR domain zinc finger protein 2; methyltransferase, activator, alternative initiation, alternative splicing, DNA-binding, metal-binding, nucleus; 1.79A {Homo sapiens} PDB: 2jv0_A* | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2f69_A Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7; SET domain, protein lysine methyltransferase, enzyme- peptide-adohcy complex; HET: MLZ SAH; 1.30A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 3m53_A* 3m55_A* 3m54_A* 3m56_A* 3m58_A* 3m57_A* 3m59_A* 3m5a_A* 1xqh_A* 4e47_A* 1n6a_A* 1o9s_A* 3cbp_A* 3cbm_A* 3cbo_A* 3os5_A* | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1n3j_A A612L, histone H3 lysine methyltransferase; beta barrel, homodimer; NMR {Paramecium bursaria chlorella virus 1} SCOP: b.85.7.2 PDB: 2g46_A* 3kma_A 3kmj_A 3kmt_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1h3i_A Histone H3 lysine 4 specific methyltransferase; 2.1A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 1mt6_A* 1n6c_A* 1muf_A | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3ep0_A PR domain zinc finger protein 12; PR domain-containing protein 12, structural genomics, structural genomics consortium, SGC, DNA-binding; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s8p_A Histone-lysine N-methyltransferase SUV420H1; SET domain, histone methyltransferase, transcription regulat histone lysine, SAM, methylation, nucleus; HET: MSE SAM; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3dal_A PR domain zinc finger protein 1; methyltransferase, PRDM1, structural genomics, structural genomics consortium, SGC, DNA-binding, metal-binding; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3db5_A PR domain zinc finger protein 4; methyltransferase, PRDM4, structural genomics, structural GE consortium, SGC, DNA-binding, metal-binding, nucleus; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3rq4_A Histone-lysine N-methyltransferase SUV420H2; suppressor, variegation 4-20 homolog 2, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3ray_A PR domain-containing protein 11; structural genomics consortium, SGC, histone methylation, Zn transcriptional regulation, chromatin, transcription; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3ihx_A PR domain zinc finger protein 10; PRDM10, methyltransferase, structural genomics, structural G consortium, SGC, DNA-binding, metal-binding, nucleus; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1weq_A PHD finger protein 7; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 322 | ||||
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 2e-13 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 2e-12 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 9e-12 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 9e-11 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 8e-10 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 9e-09 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 4e-08 | |
| d1mvha_ | 269 | b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (S | 9e-06 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 2e-04 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 3e-04 | |
| d2f69a2 | 171 | b.85.7.1 (A:194-364) Histone H3 K4-specific methyl | 0.003 | |
| d1ml9a_ | 284 | b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [T | 0.003 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 0.004 |
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Williams-Beuren syndrome transcription factor, WSTF species: Human (Homo sapiens) [TaxId: 9606]
Score = 61.9 bits (150), Expect = 2e-13
Identities = 21/45 (46%), Positives = 29/45 (64%)
Query: 62 CEQCGSGERAEELLLCDKCDKGFHMKCLRPIVVRVPIGTWLCPKC 106
C+ C ++L+LCD+C+K FH+ CLRP + VP G W CP C
Sbjct: 3 CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPAC 47
|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 269 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 171 | Back information, alignment and structure |
|---|
| >d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} Length = 284 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 322 | |||
| d1mvha_ | 269 | SET domain of Clr4 {Fission yeast (Schizosaccharom | 99.77 | |
| d1ml9a_ | 284 | Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | 99.7 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.42 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.38 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.37 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 99.09 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 99.09 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 99.07 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 99.01 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 98.89 | |
| d2f69a2 | 171 | Histone H3 K4-specific methyltransferase SET7/9 ca | 98.81 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.79 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 98.71 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 98.68 | |
| d2g46a1 | 119 | Viral histone H3 Lysine 27 Methyltransferase {Para | 98.28 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 95.21 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 93.15 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 89.36 | |
| d1weqa_ | 85 | PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculu | 88.71 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 86.86 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 85.21 |
| >d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-clip superfamily: SET domain family: Histone lysine methyltransferases domain: SET domain of Clr4 species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]
Probab=99.77 E-value=5.9e-20 Score=168.04 Aligned_cols=85 Identities=24% Similarity=0.314 Sum_probs=70.6
Q ss_pred HHHHHhCCCCCeEEEEeCCCceeeeecccCCCCceeEEeeeeehhhhhhh-----cc-CCCceeeeeccCCCCCcEEEcC
Q 020737 231 RAMCKRGECPPLVVVYDSCEGFTVEADGQIKDMTFIAEYIGDVDFIRNRE-----HD-DCDSMMTLLLATDPSKSLVICP 304 (322)
Q Consensus 231 ~r~~q~g~~~~l~v~~~~~kG~gv~a~~~I~~g~fv~EY~Gev~~~~~~~-----~~-~~~~~~~~~~~~~~~~~~vIda 304 (322)
+|++|+|.+++|+||++..+||||+|.++|++|+||+||+|||+...+.+ ++ .+.+++..+........++|||
T Consensus 127 Nr~~q~g~~~~leV~~t~~~G~GvfA~~~I~kGt~I~eY~Gevi~~~e~~~R~~~y~~~~~~~~~~l~~~~~~~~~~iDa 206 (269)
T d1mvha_ 127 NRVVQRGRTLPLEIFKTKEKGWGVRSLRFAPAGTFITCYLGEVITSAEAAKRDKNYDDDGITYLFDLDMFDDASEYTVDA 206 (269)
T ss_dssp TCTGGGCCCSCEEEEECSSSSEEEEESSCBCTTCEEEECCCEEEEHHHHHHHHTTCCSCSCCCEEEECSSCSSSCEEEEC
T ss_pred CeecCCCCccCEEEEEcCCCCeEEEeCcccCCCceEEEecceEEcHHHHHHHHHhHhhcCCcchhheecccccccceeee
Confidence 67889999999999999999999999999999999999999996544432 22 2344555555556667799999
Q ss_pred CCCCCeeeecc
Q 020737 305 DKRGNIARFIN 315 (322)
Q Consensus 305 ~~~GNiaRFiN 315 (322)
+++||+|||||
T Consensus 207 ~~~GN~aRFiN 217 (269)
T d1mvha_ 207 QNYGDVSRFFN 217 (269)
T ss_dssp SSEECGGGGCE
T ss_pred eecCcceEEee
Confidence 99999999997
|
| >d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weqa_ g.50.1.2 (A:) PHD finger protein 7 (NYD-SP6) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|