Citrus Sinensis ID: 020749

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320--
MVSVNPNPAQGFFFFDPMNMGHPGPNSLPPTGSYNAATTTNDSTTASASTKSTGAINTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTSEHVPPPRPKRKAAHPYPQKAPKTVHGVSQFGGQVQSSAALLEPGYIYRPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNFCYSSSNDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETVCYYDFLIPLSICCGHSNHVYGTAYSA
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHcccccccHHHHHHHHHHccccccccccccEEEEcccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccEccc
mvsvnpnpaqgffffdpmnmghpgpnslpptgsynaatttndsttasastkstgaintmsfaedpskkirkpytitksreswtEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVqkngtsehvppprpkrkaahpypqkapktvhgvsqfggqvqssaallepgyiyrpdsssvlgnpvpvaalsswsydsvppvnvsqvtkddvglpgssnaqnfcysssndstlrtwpvgetidrgdhgkprrvmpDFAQVYSFlgsvfdpnstghiqrlkqmdpinfetvcyydfliplsiccghsnhvygtaysa
MVSVNPNPAQGFFFFDPMNMGHPGPNSLPPTGSYNAATTTndsttasastkstgaintmsfaedpskkirkPYTITksreswteqeHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVqkngtsehvppprpkrkaaHPYPQKAPKTVHGVSQFGGQVQSSAALLEPGYIYRPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNfcysssndstlrtwpvgetidrgdhgkprrVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETVCYYDFLIPLSICCGHSNHVYGTAYSA
MVSVNPNPAQGFFFFDPMNMGHPGPNSLPPTGSYNaatttndsttasastkstGAINTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTSEHVppprpkrkaahpypQKAPKTVHGVSQFGGQVQSSAALLEPGYIYRPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNFCYSSSNDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETVCYYDFLIPLSICCGHSNHVYGTAYSA
***********FFFF***********************************************************************HDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKV********************************************ALLEPGYIYRPD**SVLGNPVPVAALSSWSYDSVPPV********************FC********LRTWPVGETI*********RVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETVCYYDFLIPLSICCGHSNHVYGTA***
*****PN******************************************************************************EHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFL********************************************************************************************************************************************VYSFLGSVF***************PINFETVCYYDFLIPLSICCGHSNHVY**A***
MVSVNPNPAQGFFFFDPMNMGHPGPNSLPPTGSYNAATT*************TGAINTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKN***************************HGVSQFGGQVQSSAALLEPGYIYRPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNFCYSSSNDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETVCYYDFLIPLSICCGHSNHVYGTAYSA
***VNPNPAQGFFFFDPMNMGHPGP*S****************************************KIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTSEHVPP*********************************************************************************************************************PRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETVCYYDFLIPLSICCGHSNHV*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSVNPNPAQGFFFFDPMNMGHPGPNSLPPTGSYNAATTTNDSTTASASTKSTGAINTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTSEHVPPPRPKRKAAHPYPQKAPKTVHGVSQFGGQVQSSAALLEPGYIYRPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNFCYSSSNDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETVCYYDFLIPLSICCGHSNHVYGTAYSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query322 2.2.26 [Sep-21-2011]
Q6R0H0287 Transcription factor ASG4 no no 0.801 0.898 0.547 2e-78
Q54IF9 423 Myb-like protein G OS=Dic yes no 0.692 0.527 0.398 4e-39
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.254 0.127 0.536 3e-21
P92973 608 Protein CCA1 OS=Arabidops no no 0.251 0.133 0.555 4e-21
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.161 0.042 0.518 2e-11
Q869R9 734 Myb-like protein J OS=Dic no no 0.167 0.073 0.418 5e-08
Q5RGA4 822 Histone H2A deubiquitinas yes no 0.177 0.069 0.379 4e-06
Q54HX6 977 Myb-like protein I OS=Dic no no 0.164 0.054 0.388 5e-06
Q5F3F2 832 Histone H2A deubiquitinas yes no 0.167 0.064 0.425 7e-06
Q5VVJ2 828 Histone H2A deubiquitinas yes no 0.173 0.067 0.410 8e-06
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function desciption
 Score =  292 bits (748), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 162/296 (54%), Positives = 195/296 (65%), Gaps = 38/296 (12%)

Query: 1   MVSVNPNPAQGFFFFDPMNMGHPGPNSLPPTGSYNAATTTNDSTTASASTKSTGAINTMS 60
           MV+VNP+ A       PM M  PG N+LP T            TT   S +S     TMS
Sbjct: 1   MVTVNPSQAHCL----PMKMSLPGFNTLPHTA-----------TTIPVSIRSN---RTMS 42

Query: 61  FAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHA 120
           F EDP+KK+RKPYTITKSRE+WTEQEHDKFLEAL LFDRDWKKI+AF+GSKTVIQIRSHA
Sbjct: 43  FFEDPTKKVRKPYTITKSRENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHA 102

Query: 121 QKYFLKVQKNGTSEHVPPPRPKRKAAHPYPQKAPKTVHGVSQFGGQVQSSAALLEPGYIY 180
           QKYFLKVQKNGT EH+PPPRPKRKA HPYPQKAPK           + SS AL +  Y+Y
Sbjct: 103 QKYFLKVQKNGTKEHLPPPRPKRKANHPYPQKAPKFT---------LSSSNALFQHDYLY 153

Query: 181 RPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNFCYSSSNDSTLR 240
             +S  V+        +      S+P    S V K++ G+     ++N C +SS+    R
Sbjct: 154 NTNSHPVISTTRKHGLVHCDV--SIP----SSVIKEEFGV-----SENCCSTSSSRDKQR 202

Query: 241 TWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFETV 296
           T  V ET D+   GKP RV P+FA+VY+F+GSVFDP +TGH++RLK+MDPIN ETV
Sbjct: 203 TRIVTETNDQESCGKPHRVAPNFAEVYNFIGSVFDPKTTGHVKRLKEMDPINLETV 258
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q5F3F2|MYSM1_CHICK Histone H2A deubiquitinase MYSM1 OS=Gallus gallus GN=MYSM1 PE=2 SV=1 Back     alignment and function description
>sp|Q5VVJ2|MYSM1_HUMAN Histone H2A deubiquitinase MYSM1 OS=Homo sapiens GN=MYSM1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
224130382356 predicted protein [Populus trichocarpa] 0.922 0.834 0.709 1e-121
356560732332 PREDICTED: transcription factor ASG4 [Gl 0.857 0.831 0.686 1e-108
359489639328 PREDICTED: transcription factor ASG4-lik 0.854 0.838 0.673 1e-106
224067932257 predicted protein [Populus trichocarpa] 0.739 0.926 0.765 1e-103
351723473331 MYB transcription factor MYB133 [Glycine 0.850 0.827 0.648 1e-100
302398983350 MYBR domain class transcription factor [ 0.913 0.84 0.653 4e-98
157043074318 transcription factor 1R-MYB1 [Chimonanth 0.835 0.845 0.629 2e-94
149727871333 MYB transcription factor MYB40 [Medicago 0.860 0.831 0.612 2e-91
356566919307 PREDICTED: transcription factor ASG4-lik 0.779 0.817 0.584 2e-88
255545170318 DNA binding protein, putative [Ricinus c 0.832 0.842 0.602 2e-87
>gi|224130382|ref|XP_002320823.1| predicted protein [Populus trichocarpa] gi|222861596|gb|EEE99138.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 215/303 (70%), Positives = 246/303 (81%), Gaps = 6/303 (1%)

Query: 1   MVSVNPNPAQGFFFFDPMN----MGHPGPNSLPPTGSYNAATTTNDSTTASASTKSTGAI 56
           MVSVNPNPA GF+FFDPMN    M  PG N LPPT +  A  T ND+ +A+ +T +T   
Sbjct: 1   MVSVNPNPALGFYFFDPMNNSSHMELPGVNFLPPTNTNTATDTCNDTVSAANTTTTTNNN 60

Query: 57  --NTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVI 114
               +SF+EDP+KKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAF+GSKTVI
Sbjct: 61  NHKLVSFSEDPNKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFVGSKTVI 120

Query: 115 QIRSHAQKYFLKVQKNGTSEHVPPPRPKRKAAHPYPQKAPKTVHGVSQFGGQVQSSAALL 174
           QIRSHAQKYFLKVQK+GTSEHVPPPRPKRKAAHPYPQKAPK+    SQ  G  QSS+ALL
Sbjct: 121 QIRSHAQKYFLKVQKSGTSEHVPPPRPKRKAAHPYPQKAPKSAAVASQVTGSFQSSSALL 180

Query: 175 EPGYIYRPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNFCYSSS 234
           EPGY+YRPDS+SVLGNP+   ALS+WS++SVPPV++SQ+T DD GL G + A   CYSSS
Sbjct: 181 EPGYLYRPDSTSVLGNPITSGALSTWSFNSVPPVSMSQMTNDDAGLAGPTIANKCCYSSS 240

Query: 235 NDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFE 294
           N+S  RTW  G+ ID+   GKP RVMPDFAQVYSF+G+VFDPN + H+QRLKQMDPIN E
Sbjct: 241 NESASRTWQTGKIIDKRAQGKPERVMPDFAQVYSFIGNVFDPNGSDHLQRLKQMDPINLE 300

Query: 295 TVC 297
           TV 
Sbjct: 301 TVL 303

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356560732|ref|XP_003548642.1| PREDICTED: transcription factor ASG4 [Glycine max] Back     alignment and taxonomy information
>gi|359489639|ref|XP_003633954.1| PREDICTED: transcription factor ASG4-like [Vitis vinifera] gi|297745319|emb|CBI40399.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224067932|ref|XP_002302605.1| predicted protein [Populus trichocarpa] gi|222844331|gb|EEE81878.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351723473|ref|NP_001237536.1| MYB transcription factor MYB133 [Glycine max] gi|110931716|gb|ABH02857.1| MYB transcription factor MYB133 [Glycine max] Back     alignment and taxonomy information
>gi|302398983|gb|ADL36786.1| MYBR domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|157043074|gb|ABV02070.1| transcription factor 1R-MYB1 [Chimonanthus praecox] Back     alignment and taxonomy information
>gi|149727871|gb|ABR28335.1| MYB transcription factor MYB40 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356566919|ref|XP_003551672.1| PREDICTED: transcription factor ASG4-like [Glycine max] Back     alignment and taxonomy information
>gi|255545170|ref|XP_002513646.1| DNA binding protein, putative [Ricinus communis] gi|223547554|gb|EEF49049.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query322
TAIR|locus:2124928303 AT4G01280 [Arabidopsis thalian 0.732 0.778 0.542 4.8e-66
TAIR|locus:2025411287 ASG4 "ALTERED SEED GERMINATION 0.496 0.557 0.518 1.1e-60
TAIR|locus:2149589331 AT5G52660 [Arabidopsis thalian 0.860 0.836 0.479 1.2e-58
TAIR|locus:2075049298 RVE8 "REVEILLE 8" [Arabidopsis 0.708 0.765 0.481 2.9e-48
TAIR|locus:2151251293 LCL1 "LHY/CCA1-like 1" [Arabid 0.714 0.784 0.477 6.2e-46
DICTYBASE|DDB_G0288783 423 mybG "myb domain-containing pr 0.220 0.167 0.774 3.4e-34
TAIR|locus:2044345 608 CCA1 "circadian clock associat 0.251 0.133 0.555 4.5e-21
TAIR|locus:2167210387 RVE1 "REVEILLE 1" [Arabidopsis 0.236 0.196 0.584 1e-20
TAIR|locus:2169135287 RVE2 "REVEILLE 2" [Arabidopsis 0.204 0.229 0.626 1.9e-19
TAIR|locus:504955668336 AT3G10113 [Arabidopsis thalian 0.204 0.196 0.575 3.1e-19
TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 617 (222.3 bits), Expect = 4.8e-66, Sum P(2) = 4.8e-66
 Identities = 133/245 (54%), Positives = 163/245 (66%)

Query:    54 GAINTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTV 113
             G  +T+SF+EDP+ KIRKPYTI KSRE+WT+QEHDKFLEAL LFDRDWKKIEAF+GSKTV
Sbjct:    34 GRTSTVSFSEDPTTKIRKPYTIKKSRENWTDQEHDKFLEALHLFDRDWKKIEAFVGSKTV 93

Query:   114 IQIRSHAQKYFLKVQKNGTSEHVXXXXXXXXXXXXXXQKAPKTVHGVSQFGGQVQSSAAL 173
             +QIRSHAQKYFLKVQK+G +EH+               KAPK V   S       S+  L
Sbjct:    94 VQIRSHAQKYFLKVQKSGANEHLPPPRPKRKASHPYPIKAPKNVAYTSL---PSSSTLPL 150

Query:   174 LEPGYIYRPDSSSVLGNPVPVAALSS-WSYDSVP-PVNVSQVTKDDVGLPGSSNAQNFCY 231
             LEPGY+Y  DS S++GN    A+ SS W+++S   P  V +V +  V         N C 
Sbjct:   151 LEPGYLYSSDSKSLMGNQAVCASTSSSWNHESTNLPKPVIEVEEPGVSATAPL-PNNRC- 208

Query:   232 SSSNDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPI 291
                 + T R   V +  +     KP RVMP+FA+VYSF+GSVFDPN++GH+QRLKQMDPI
Sbjct:   209 --RQEDTERVRAVTKPNNEESCEKPHRVMPNFAEVYSFIGSVFDPNTSGHLQRLKQMDPI 266

Query:   292 NFETV 296
             N ETV
Sbjct:   267 NMETV 271
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009733 "response to auxin stimulus" evidence=IEP;RCA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;RCA
GO:0009739 "response to gibberellin stimulus" evidence=IEP;RCA
GO:0009751 "response to salicylic acid stimulus" evidence=IEP;RCA
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0000303 "response to superoxide" evidence=RCA
GO:0009736 "cytokinin mediated signaling pathway" evidence=RCA
GO:0009873 "ethylene mediated signaling pathway" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149589 AT5G52660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288783 mybG "myb domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955668 AT3G10113 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00140348
hypothetical protein (356 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 9e-17
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-11
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-09
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 7e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 0.003
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
 Score = 72.8 bits (179), Expect = 9e-17
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 77  KSRESWTEQEHDKFLEALQLFDR-DW---KKI-EAFIGSK-TVIQIRSHAQKYFLKV 127
           K R  WTE  HD+FL+A+Q     DW   K+I E  +    T  Q+ SH QKY LK 
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 322
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.58
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.52
KOG0724335 consensus Zuotin and related molecular chaperones 99.47
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.21
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.18
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.12
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.91
PLN03212249 Transcription repressor MYB5; Provisional 98.83
PLN03091 459 hypothetical protein; Provisional 98.76
PLN03212249 Transcription repressor MYB5; Provisional 98.74
PLN03091 459 hypothetical protein; Provisional 98.63
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.52
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.51
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.43
KOG1279506 consensus Chromatin remodeling factor subunit and 98.3
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.29
PLN03162526 golden-2 like transcription factor; Provisional 97.92
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.71
KOG4468 782 consensus Polycomb-group transcriptional regulator 96.97
KOG0051607 consensus RNA polymerase I termination factor, Myb 96.81
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.79
KOG0049 939 consensus Transcription factor, Myb superfamily [T 96.48
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 96.34
KOG0051607 consensus RNA polymerase I termination factor, Myb 96.25
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 95.7
KOG4329445 consensus DNA-binding protein [General function pr 95.51
COG5147 512 REB1 Myb superfamily proteins, including transcrip 95.5
KOG4167907 consensus Predicted DNA-binding protein, contains 95.16
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.08
KOG1194 534 consensus Predicted DNA-binding protein, contains 93.85
KOG3841 455 consensus TEF-1 and related transcription factor, 93.77
PF11035344 SnAPC_2_like: Small nuclear RNA activating complex 93.75
COG5147 512 REB1 Myb superfamily proteins, including transcrip 92.87
KOG0724335 consensus Zuotin and related molecular chaperones 92.44
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 92.24
PLN031421033 Probable chromatin-remodeling complex ATPase chain 91.62
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 91.36
smart0042668 TEA TEA domain. 91.2
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 91.06
KOG4282345 consensus Transcription factor GT-2 and related pr 91.02
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 90.23
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 89.32
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 88.4
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 86.55
PRK13923170 putative spore coat protein regulator protein YlbO 83.32
PF0450498 DUF573: Protein of unknown function, DUF573; Inter 80.17
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information 
Probab=99.58  E-value=2.7e-15  Score=112.39  Aligned_cols=50  Identities=48%  Similarity=0.727  Sum_probs=46.0

Q ss_pred             cCCCCCCHHHHHHHHHHHHHcCc-hH---HHHHHHhC-CC-CHHHHHHHHHHHHHH
Q 020749           77 KSRESWTEQEHDKFLEALQLFDR-DW---KKIEAFIG-SK-TVIQIRSHAQKYFLK  126 (322)
Q Consensus        77 k~r~~WT~EEhelFLeaLk~yGr-dW---kkIA~~Vg-TR-T~~QcRSHaQKYf~k  126 (322)
                      |.|..||+|||++||+||+.||+ +|   ++|+++++ ++ |..||+||+||||.+
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k   56 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK   56 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence            46789999999999999999997 99   99998765 67 999999999999976

This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF04504 DUF573: Protein of unknown function, DUF573; InterPro: IPR007592 This is a family of uncharacterised proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
2cu7_A72 Solution Structure Of The Sant Domain Of Human Kiaa 1e-06
>pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 Back     alignment and structure 
Iteration: 1

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 32/50 (64%)
Query: 82  WTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNG 131
           WT +E + F + L  F R W KI   IGS+TV+Q++S+A++YF    K G
Sbjct: 12  WTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCG 61

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query322
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-27
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 2e-20
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-20
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 3e-16
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 5e-14
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 7e-14
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 6e-11
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 3e-10
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 9e-10
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 3e-07
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
2cjj_A93 Radialis; plant development, DNA-binding protein, 5e-06
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 5e-06
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 1e-05
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score =  100 bits (251), Expect = 3e-27
 Identities = 23/65 (35%), Positives = 36/65 (55%)

Query: 76  TKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTSEH 135
           +     WT +E + F + L  F R W KI   IGS+TV+Q++S+A++YF    K G  + 
Sbjct: 6   SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65

Query: 136 VPPPR 140
            P  +
Sbjct: 66  TPNQK 70
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.67
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.66
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.64
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.54
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.53
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.46
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.45
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.43
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.42
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.42
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.39
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.37
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.36
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.35
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.99
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.31
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.29
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.25
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.23
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.2
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.2
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.18
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.17
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.15
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.15
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.14
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.11
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.11
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.05
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.04
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.04
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.02
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.01
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.97
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.97
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.92
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.92
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.89
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.87
2crg_A70 Metastasis associated protein MTA3; transcription 98.86
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.85
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.82
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.7
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.62
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.6
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.8
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.77
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.54
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.2
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 96.99
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 96.77
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.74
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.64
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.85
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.74
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.8
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 93.72
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 93.29
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 90.45
1ig6_A107 MRF-2, modulator recognition factor 2; DNA binding 89.93
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 88.09
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 87.18
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 83.36
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.67  E-value=1.9e-16  Score=120.17  Aligned_cols=57  Identities=39%  Similarity=0.673  Sum_probs=52.5

Q ss_pred             ccCCCCCCHHHHHHHHHHHHHcCchHHHHHHHhCCCCHHHHHHHHHHHHHHHhhcCC
Q 020749           76 TKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGT  132 (322)
Q Consensus        76 ~k~r~~WT~EEhelFLeaLk~yGrdWkkIA~~VgTRT~~QcRSHaQKYf~kl~k~g~  132 (322)
                      ..+++.||+|||++|++++++||.+|..||++|++||..|||+||++||.+..+.|.
T Consensus         6 ~~~~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~r~~~~l~~~~~~g~   62 (72)
T 2cu7_A            6 SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGL   62 (72)
T ss_dssp             SSCCCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCSCT
T ss_pred             CcCCCCCCHHHHHHHHHHHHHHCcCHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcCC
Confidence            346789999999999999999999999999999999999999999999999876643
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 322
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 2e-15
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 2e-14
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-13
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-12
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 4e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 7e-09
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 6e-07
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 9e-07
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 2e-05
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 7e-05
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-04
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 67.6 bits (165), Expect = 2e-15
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 5/58 (8%)

Query: 77  KSRESWTEQEHDKFLEALQLFDRDWKKIEA-----FIGSKTVIQIRSHAQKYFLKVQK 129
           K R  WT + H+KFL A+     +    +       +   T   + SH QK+ + ++K
Sbjct: 5   KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK 62
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query322
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.63
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.58
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.51
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.46
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.43
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.41
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.37
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.34
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.33
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.29
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.22
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.19
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.1
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.04
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.87
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.81
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.54
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.42
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 97.1
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.22
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 86.66
d1ig6a_107 MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta 83.09
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: MYSM1 (KIAA1915)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.63  E-value=3.7e-16  Score=114.32  Aligned_cols=56  Identities=39%  Similarity=0.704  Sum_probs=51.4

Q ss_pred             CCCCCHHHHHHHHHHHHHcCchHHHHHHHhCCCCHHHHHHHHHHHHHHHhhcCCCC
Q 020749           79 RESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTSE  134 (322)
Q Consensus        79 r~~WT~EEhelFLeaLk~yGrdWkkIA~~VgTRT~~QcRSHaQKYf~kl~k~g~~e  134 (322)
                      ...||.|||++|+++|++||++|..||++|++||..|||+||++|+.+..+.+...
T Consensus         2 ~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~ry~~~~~~~~k~~~~~   57 (65)
T d2cu7a1           2 SVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDK   57 (65)
T ss_dssp             CCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCSCTTC
T ss_pred             CCCCCHHHHHHHHHHHHHhcchHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcCCCC
Confidence            36799999999999999999999999999999999999999999999987766543
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure