Citrus Sinensis ID: 020776

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-

MATAIVRSAKNFRNLHQRFYFHTLLTKCRPPIPSPTIADNIQHRALPLIQQAIPFGIGFQSFVADQRFSSTSTTTGTVQSGHSKPNSEGGDKSGDSNQSKSDTGKPIRGGPISWLSFLLLALTGAGIIWYYDKEKEQHIEEINSASQAVKQGPSVGKAAIGGPFKLINHDGKNVTEKDFLGKWTVIYFGFTHCPDICPDELQKLAAAVDKIKENSGIDIVPAFISVDPERDTVEQVREYVKEFHPKLIGLTGSPDEIRNIARAYRVYYMKTAEEDSDYLVDHSIVMYLMSPKMEFVKFFGKNNDVNSLADGIIKEIKQYKR

cHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccCECcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHccccEECcccHHHHHHHHHHccEEEEEEcccccccEEEccEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHc

*******SAKNFRNLHQRFYFHTLLTKCRPPIPSPTIADNIQHRALPLIQQAIPFGIGFQSFVAD*******************************************GGPISWLSFLLLALTGAGIIWYYDKEK*********************KAAIGGPFKLINHDGKNVTEKDFLGKWTVIYFGFTHCPDICPDELQKLAAAVDKIKENSGIDIVPAFISVDPERDTVEQVREYVKEFHPKLIGLTGSPDEIRNIARAYRVYYMKTAEEDSDYLVDHSIVMYLMSPKMEFVKFFGKNNDVNSLADGIIKEIKQY**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein SCO1 homolog 1, mitochondrial	Thought to play a role in cellular copper homeostasis, mitochondrial redox signaling or insertion of copper into the active site of COX. Plays an essential role in embryo development.	probable	Q8VYP0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GGT, chain A
Confidence level:very confident
Coverage over the Query: 161-320
View the alignment between query and template
View the model in PyMOL