Citrus Sinensis ID: 020798

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-

MSSDQSLESFRPYTLTQTLNGHLRAISSVKFSHDGRLLASSSADKTLLTYSLSSISNSDSTPPSPLQKFTGHEQGVSDLVFSSDSRFLVSASDDKTIRLWDVPTATCLKTLIGHTNYVFCVNFNPQSNMIVSGAFDETVRIWDVKTGKCLKVLPAHSDPVTAVDFNRDGTMIVTSSYDGLCRIWDASTGHCMKTLIDDENPPVSFVKFSPNGKFILVGTLDNTLRLWNYSTGKILKTYTGHTNSKYCISSTFSVTNGKYIVSGSEDSCVYLWELQSRKVVQKLEGHTDPVISVASHPTENIIASGALDNDRTVKIWTQEKE

ccccccEEEECccccccccccccccEEEEEEcccccEEEEEcccccEEEEcccccccccccccccEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEccccCEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEccccCEEEEEEcccccEEEEEEEEEcccccEEEEccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEccccccEEEEEEcccc

**SDQSLESFRPYTLTQTLNGHLRAISSVKFSHDGRLLASSSADKTLLTYSLSSISNSDSTPPSPLQKFTGHEQGVSDLVFSSDSRFLVSASDDKTIRLWDVPTATCLKTLIGHTNYVFCVNFNPQSNMIVSGAFDETVRIWDVKTGKCLKVLPAHSDPVTAVDFNRDGTMIVTSSYDGLCRIWDASTGHCMKTLIDDENPPVSFVKFSPNGKFILVGTLDNTLRLWNYSTGKILKTYTGHTNSKYCISSTFSVTNGKYIVSGSEDSCVYLWELQSRKVVQKLEGHTDPVISVASHPTENIIASGALDNDRTVKIWTQEK*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
WD repeat-containing protein 5	Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation.	probable	P61964
WD repeat-containing protein 5	Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation.	probable	P61965
WD repeat-containing protein 5	Contributes to histone modification. May position the N-terminus of histone H3 for efficient trimethylation at 'Lys-4'. As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. May regulate osteoblasts differentiation.	probable	Q5M786

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FRX, chain A
Confidence level:very confident
Coverage over the Query: 13-318
View the alignment between query and template
View the model in PyMOL