Citrus Sinensis ID: 020799

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-

MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPAPQPSPGPSLPRTPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVTGTSTPAPAAPPPLPPPPPPGNRTSPAPVPPPVQPPPSRQPPPPPASVAPCQVVGGFYITILSIIAVALISSSVE

ccHHHHHHHHHHHHHHHHHHccccCEEEEEcccccccccccccccccccccccEEEEccEEEEEEccccccEEEEcHHHHcccccccccccccccccEEEEcccccEEEEcccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEEEccccccEEEEcHHHHccccccccccccccccCEEEEcccccEEEEcccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcc

***TIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPA******PSLPRTPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVT****************************************************VGGFYITILSIIAVALISSSVE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx

SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JER, chain A
Confidence level:very confident
Coverage over the Query: 143-250
View the alignment between query and template
View the model in PyMOL

Template: 1JER, chain A
Confidence level:very confident
Coverage over the Query: 24-131
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 249-261
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
1pk8, chain A		probable	Alignment \| Template Structure