Citrus Sinensis ID: 020799

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPAPQPSPGPSLPRTPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVTGTSTPAPAAPPPLPPPPPPGNRTSPAPVPPPVQPPPSRQPPPPPASVAPCQVVGGFYITILSIIAVALISSSVE
ccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccEEEEccEEEEEEccccccEEEEcHHHHcccccccccccccccccEEEEcccccEEEEcccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEccEEEEEEccccccEEEEcHHHHccccccccccccccccEEEEEcccccEEEEcccccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccEEcccccccHHHHHccccEEEccEEEEEEccccccEEEEcHHHHHHccccccccEccccccEEEEcccccEEEEEccccccccccEEEEEEEcccccccccccccccccccEEccccccEccccccccHHHHcccccEEEccEEEEEEccccccEEEEcHHHHHHcccccccHEEcccccEEEEcccccEEEEEccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcc
MARTIILAIAVTASMASLLQNTAAetthvvggdlgwqippggaIAYVTWASMQTFSVGDILLfnfttgqqDVASVTKEAyencnpaspisrkttgpaefsleaagdYYFICTLELHCTLGQKLAihvtgpapqpspgpslprtpvnytvggnigwaippggalFYASWASFYSFFVCDTLVfnfangtqdvaivpkdvyetcninstiavftsspvkitlkfpgeyyftstylshcslgqrlainvtgtstpapaappplppppppgnrtspapvpppvqpppsrqpppppasvapcqvvGGFYITILSIIAVALISSSVE
MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENcnpaspisrkttgPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPAPQPSPGPSLPRTPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINstiavftsspvKITLKFPGEYYFTSTYLSHCSLGQRLAINVTGTSTPAPAAPPPLPPPPPPGNRTSPAPVPPPVQPPPSRQPPPPPASVAPCQVVGGFYITILSIIAVALISSSVE
MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVtgpapqpspgpslprtpVNYTVGGNIGWAIPPGGALfyaswasfysffVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVTGTSTpapaappplppppppGNRTspapvpppvqpppsrqpppppasvapcqvvGGFYITilsiiavalisssvE
***TIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAY*****************EFSLEAAGDYYFICTLELHCTLGQKLAIHVT***************PVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVT**************************************************************************
******LAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPAPQPSPGPSLPRTPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAIN******************************************************VGGFYITILSIIAVALISSSVE
MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTG********PSLPRTPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVTGTSTPAPAAPPPLPPPPPPG*************************SVAPCQVVGGFYITILSIIAVALISSSVE
*ARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPA**************NYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVTGT***********************************************CQVVGGFYITILSIIAVALISSS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHi
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooo
ooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHi
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPAPQPSPGPSLPRTPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLSHCSLGQRLAINVTGTSTPAPAAPPPLPPPPPPGNRTSPAPVPPPVQPPPSRQPPPPPASVAPCQVVGGFYITILSIIAVALISSSVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query321 2.2.26 [Sep-21-2011]
P42849115 Umecyanin OS=Armoracia ru N/A no 0.302 0.843 0.489 9e-21
Q9SK27182 Early nodulin-like protei yes no 0.411 0.725 0.370 2e-19
Q07488196 Blue copper protein OS=Ar no no 0.355 0.581 0.426 8e-18
P00302107 Stellacyanin OS=Toxicoden N/A no 0.320 0.962 0.394 9e-18
P80728108 Mavicyanin OS=Cucurbita p N/A no 0.305 0.907 0.394 2e-14
Q41001189 Blue copper protein OS=Pi N/A no 0.305 0.518 0.431 6e-14
P29602137 Cucumber peeling cupredox N/A no 0.314 0.737 0.394 2e-13
Q9T076349 Early nodulin-like protei no no 0.299 0.275 0.377 3e-12
Q8LC95186 Early nodulin-like protei no no 0.342 0.591 0.351 3e-12
P93328180 Early nodulin-16 OS=Medic N/A no 0.364 0.65 0.289 3e-09
>sp|P42849|UMEC_ARMRU Umecyanin OS=Armoracia rusticana PE=1 SV=1 Back     alignment and function desciption
 Score =  101 bits (251), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 30  VGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPI 89
           VGGD+ W+ P      Y+TWA+ +TF VGD L F+F  G  DVA VTK+A++NC   +PI
Sbjct: 5   VGGDMEWKRPSDPKF-YITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPI 63

Query: 90  SRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHV 127
           S  TT P +  L   G  Y+ICT+  HC +GQKL+I+V
Sbjct: 64  SHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINV 101
Not yet known.
Armoracia rusticana (taxid: 3704)
>sp|Q9SK27|ENL1_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana GN=At2g25060 PE=1 SV=2 Back     alignment and function description
>sp|Q07488|BCB1_ARATH Blue copper protein OS=Arabidopsis thaliana GN=BCB PE=1 SV=2 Back     alignment and function description
>sp|P00302|STEL_TOXVR Stellacyanin OS=Toxicodendron vernicifluum PE=1 SV=1 Back     alignment and function description
>sp|P80728|MAVI_CUCPE Mavicyanin OS=Cucurbita pepo PE=1 SV=1 Back     alignment and function description
>sp|Q41001|BCP_PEA Blue copper protein OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P29602|CPC_CUCSA Cucumber peeling cupredoxin OS=Cucumis sativus PE=1 SV=3 Back     alignment and function description
>sp|Q9T076|ENL2_ARATH Early nodulin-like protein 2 OS=Arabidopsis thaliana GN=At4g27520 PE=1 SV=1 Back     alignment and function description
>sp|Q8LC95|ENL3_ARATH Early nodulin-like protein 3 OS=Arabidopsis thaliana GN=At5g25090 PE=1 SV=2 Back     alignment and function description
>sp|P93328|NO16_MEDTR Early nodulin-16 OS=Medicago truncatula GN=ENOD16 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
255572517312 Early nodulin 16 precursor, putative [Ri 0.934 0.961 0.523 8e-80
449493699 499 PREDICTED: uncharacterized protein LOC10 0.934 0.601 0.512 1e-76
449443291348 PREDICTED: uncharacterized protein LOC10 0.903 0.833 0.523 9e-76
225445555304 PREDICTED: uncharacterized protein LOC10 0.732 0.773 0.598 9e-68
297738975301 unnamed protein product [Vitis vinifera] 0.732 0.780 0.585 2e-67
350535054332 dicyanin precursor [Solanum lycopersicum 0.822 0.795 0.448 4e-62
225445553298 PREDICTED: blue copper protein [Vitis vi 0.728 0.785 0.475 3e-58
147780459299 hypothetical protein VITISV_018636 [Viti 0.728 0.782 0.471 8e-57
297743460 624 unnamed protein product [Vitis vinifera] 0.769 0.395 0.434 4e-54
356548479336 PREDICTED: uncharacterized protein LOC10 0.760 0.726 0.417 2e-51
>gi|255572517|ref|XP_002527193.1| Early nodulin 16 precursor, putative [Ricinus communis] gi|223533458|gb|EEF35206.1| Early nodulin 16 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  303 bits (775), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 166/317 (52%), Positives = 208/317 (65%), Gaps = 17/317 (5%)

Query: 1   MARTIILAIAVTASMASLLQNTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDI 60
           M++ + +AI   A  ASLL  T A+T  VVG  LGW +PPGG +AY TWA++ TF+VGD+
Sbjct: 1   MSKIVSVAILAIA-FASLLNTTTAKTL-VVGDGLGWLVPPGGDLAYATWAAINTFTVGDV 58

Query: 61  LLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLG 120
           L+FNFTTGQQDVA VTKEAY  CN  +PI+ KTTGPA F+L+  G Y+FI T++ HC LG
Sbjct: 59  LVFNFTTGQQDVARVTKEAYLFCNSTNPIALKTTGPANFTLDTTGAYFFISTMDKHCPLG 118

Query: 121 QKLAIHVTGPAPQPSPGPSLP------RTPVNYTVGGNIGWAIPPGGALFYASWASFYSF 174
           Q+LAI+VT P P PSPGP         R PV YTVG  +GW +PPGGAL Y +WA   +F
Sbjct: 119 QRLAIYVTAPGPYPSPGPHTAPSPVPNRAPVTYTVGDGMGWIVPPGGALAYMTWAYNKTF 178

Query: 175 FVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPGEYYFTSTYLS 234
            V D LVFNF +G QDVA+V K+ YETCN NSTI V+++SP  I L   G+Y+FTSTY +
Sbjct: 179 IVGDVLVFNFVDGLQDVALVTKEAYETCNTNSTIQVWSTSPANILLNATGDYFFTSTYPN 238

Query: 235 HCSLGQRLAINVTG-TSTPAPAAPPPLPPPPPPGNRTSPAPVPPPVQPPPSRQPPPPPAS 293
            C LGQ+LAI V   T T    APP     PP  + +  + V        +  P  PP S
Sbjct: 239 RCILGQQLAIRVVASTGTGGVLAPPSGIVNPPTSSSSISSLV--------TEGPAAPPVS 290

Query: 294 VAPCQVVGGFYITILSI 310
            AP   V GF+IT++SI
Sbjct: 291 SAPSPAVAGFFITLVSI 307

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449493699|ref|XP_004159418.1| PREDICTED: uncharacterized protein LOC101231160 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443291|ref|XP_004139413.1| PREDICTED: uncharacterized protein LOC101206368 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225445555|ref|XP_002282262.1| PREDICTED: uncharacterized protein LOC100268054 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297738975|emb|CBI28220.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|350535054|ref|NP_001234429.1| dicyanin precursor [Solanum lycopersicum] gi|7670832|gb|AAF66242.1|AF243180_1 dicyanin [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|225445553|ref|XP_002285304.1| PREDICTED: blue copper protein [Vitis vinifera] Back     alignment and taxonomy information
>gi|147780459|emb|CAN60011.1| hypothetical protein VITISV_018636 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743460|emb|CBI36327.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356548479|ref|XP_003542629.1| PREDICTED: uncharacterized protein LOC100805802 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query321
TAIR|locus:2040164182 ENODL14 "early nodulin-like pr 0.339 0.598 0.390 6.5e-19
TAIR|locus:2149249196 BCB "blue-copper-binding prote 0.302 0.494 0.469 1.4e-18
TAIR|locus:2116767177 ENODL15 "early nodulin-like pr 0.380 0.689 0.376 2.2e-18
TAIR|locus:2052866200 AT2G31050 [Arabidopsis thalian 0.342 0.55 0.407 5.3e-17
TAIR|locus:2062525261 UCC1 "uclacyanin 1" [Arabidops 0.370 0.455 0.357 1.8e-16
TAIR|locus:2151069187 AT5G26330 [Arabidopsis thalian 0.376 0.647 0.370 9.8e-16
TAIR|locus:2043833206 AT2G26720 [Arabidopsis thalian 0.308 0.480 0.411 1.6e-15
TAIR|locus:2085775203 ENODL9 "early nodulin-like pro 0.302 0.477 0.377 2e-15
TAIR|locus:1009023108369 AT1G45063 [Arabidopsis thalian 0.710 0.617 0.267 3.9e-14
TAIR|locus:2179240186 ENODL13 "early nodulin-like pr 0.342 0.591 0.351 6.2e-14
TAIR|locus:2040164 ENODL14 "early nodulin-like protein 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 6.5e-19, P = 6.5e-19
 Identities = 43/110 (39%), Positives = 63/110 (57%)

Query:    19 LQNTAAETTHVVGGDLG-WQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTK 77
             L + AA     VGG  G W+IPP  + ++  WA    F VGD ++F + +G+  V  VTK
Sbjct:    22 LFSLAAANEVTVGGKSGDWKIPPSSSYSFTEWAQKARFKVGDFIVFRYESGKDSVLEVTK 81

Query:    78 EAYENCNPASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHV 127
             EAY +CN  +P++  T G  +  L+ +G +YFI     HC  GQKL++ V
Sbjct:    82 EAYNSCNTTNPLANYTDGETKVKLDRSGPFYFISGANGHCEKGQKLSLVV 131
GO:0005507 "copper ion binding" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0031225 "anchored to membrane" evidence=TAS
GO:0046658 "anchored to plasma membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
GO:0016572 "histone phosphorylation" evidence=RCA
TAIR|locus:2149249 BCB "blue-copper-binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116767 ENODL15 "early nodulin-like protein 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052866 AT2G31050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062525 UCC1 "uclacyanin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151069 AT5G26330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043833 AT2G26720 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085775 ENODL9 "early nodulin-like protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:1009023108 AT1G45063 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179240 ENODL13 "early nodulin-like protein 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 3e-26
pfam0229884 pfam02298, Cu_bind_like, Plastocyanin-like domain 4e-22
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 6e-15
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits ga 5e-06
PLN03148167 PLN03148, PLN03148, Blue copper-like protein; Prov 8e-06
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits ga 4e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-05
pfam13388 422 pfam13388, DUF4106, Protein of unknown function (D 4e-05
pfam04652315 pfam04652, DUF605, Vta1 like 4e-05
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 6e-05
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 9e-05
PRK14952 584 PRK14952, PRK14952, DNA polymerase III subunits ga 9e-05
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-04
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 1e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 2e-04
COG5178 2365 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p 2e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 2e-04
pfam03276 582 pfam03276, Gag_spuma, Spumavirus gag protein 2e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 3e-04
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 3e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 4e-04
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-04
PRK12323 700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 5e-04
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 5e-04
PRK00404141 PRK00404, tatB, sec-independent translocase; Provi 5e-04
PRK14963504 PRK14963, PRK14963, DNA polymerase III subunits ga 5e-04
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 5e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 6e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 6e-04
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 6e-04
pfam10152147 pfam10152, DUF2360, Predicted coiled-coil domain-c 7e-04
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 7e-04
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 8e-04
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 8e-04
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 8e-04
PRK14965 576 PRK14965, PRK14965, DNA polymerase III subunits ga 9e-04
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 9e-04
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; 0.001
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.001
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.001
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.001
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PRK14951 618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.002
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 0.002
PRK14948 620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.002
PRK07994 647 PRK07994, PRK07994, DNA polymerase III subunits ga 0.002
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.002
PRK14971 614 PRK14971, PRK14971, DNA polymerase III subunits ga 0.002
PLN02258 590 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen 0.002
pfam06003264 pfam06003, SMN, Survival motor neuron protein (SMN 0.002
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.003
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.003
PRK14950 585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.003
PRK01297 475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 0.003
pfam07174 297 pfam07174, FAP, Fibronectin-attachment protein (FA 0.003
pfam09849234 pfam09849, DUF2076, Uncharacterized protein conser 0.003
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.004
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.004
PRK14948620 PRK14948, PRK14948, DNA polymerase III subunits ga 0.004
PLN02744 539 PLN02744, PLN02744, dihydrolipoyllysine-residue ac 0.004
PRK03427 333 PRK03427, PRK03427, cell division protein ZipA; Pr 0.004
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information 
 Score = 98.9 bits (247), Expect = 3e-26
 Identities = 36/77 (46%), Positives = 44/77 (57%)

Query: 45  AYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFSLEAA 104
            Y  WAS +TF VGD L+FN+  G  +V  VTK  YE+CN + PI   TTG     L   
Sbjct: 8   DYTLWASGKTFRVGDTLVFNYDKGFHNVVEVTKADYESCNTSKPIRTYTTGNDIIPLTKP 67

Query: 105 GDYYFICTLELHCTLGQ 121
           G +YFIC +  HC  GQ
Sbjct: 68  GQHYFICGVPGHCKGGQ 84

This family represents a domain found in flowering plants related to the copper binding protein plastocyanin. Some members of this family may not bind copper due to the lack of key residues. Length = 84
>gnl|CDD|216965 pfam02298, Cu_bind_like, Plastocyanin-like domain Back     alignment and domain information
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|178693 PLN03148, PLN03148, Blue copper-like protein; Provisional Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional Back     alignment and domain information
>gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED Back     alignment and domain information
>gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) Back     alignment and domain information
>gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 321
PLN03148167 Blue copper-like protein; Provisional 100.0
PLN03148167 Blue copper-like protein; Provisional 100.0
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.96
PF0229885 Cu_bind_like: Plastocyanin-like domain; InterPro: 99.96
PRK02710119 plastocyanin; Provisional 98.49
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.33
PF0012799 Copper-bind: Copper binding proteins, plastocyanin 98.13
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 98.1
TIGR0265699 cyanin_plasto plastocyanin. Members of this family 97.99
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 97.87
TIGR03102115 halo_cynanin halocyanin domain. Halocyanins are bl 97.87
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.78
COG3794128 PetE Plastocyanin [Energy production and conversio 97.78
COG3794128 PetE Plastocyanin [Energy production and conversio 97.73
TIGR02375116 pseudoazurin pseudoazurin. Pseudoazurin, also call 97.72
PRK02710119 plastocyanin; Provisional 97.44
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 97.43
TIGR0265783 amicyanin amicyanin. Members of this family are am 97.03
TIGR0265783 amicyanin amicyanin. Members of this family are am 96.55
TIGR03095148 rusti_cyanin rusticyanin. Rusticyanin is a blue co 96.51
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 95.91
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 95.83
PF06525196 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb 95.75
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 93.85
PF00812145 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a 93.81
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 93.6
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 93.42
COG4454158 Uncharacterized copper-binding protein [Inorganic 92.44
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 91.57
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 90.41
TIGR03094195 sulfo_cyanin sulfocyanin. Members of this family a 90.26
COG4454158 Uncharacterized copper-binding protein [Inorganic 89.86
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 88.89
TIGR02695125 azurin azurin. Azurin is a blue copper-binding pro 88.52
PF05283186 MGC-24: Multi-glycosylated core protein 24 (MGC-24 88.46
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 87.48
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 84.63
PF0717295 GRP: Glycine rich protein family; InterPro: IPR010 84.26
KOG3858233 consensus Ephrin, ligand for Eph receptor tyrosine 84.04
TIGR02376311 Cu_nitrite_red nitrite reductase, copper-containin 83.32
PLN02354 552 copper ion binding / oxidoreductase 81.01
>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.1e-39  Score=282.35  Aligned_cols=106  Identities=35%  Similarity=0.661  Sum_probs=98.9

Q ss_pred             ccccceEEEeeCCCCCcCCCCCCcCcccccCCCeeEeCCEEEEEecCCCccEEEeCcccccccCCCCCCCccCCCCcEEE
Q 020799           21 NTAAETTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPISRKTTGPAEFS  100 (321)
Q Consensus        21 ~~aaa~~~~VGg~~GW~~~~~~~~~Y~~Was~~~F~vGD~LvF~y~~~~hsV~~v~~~~Y~~C~~~~~~~~~~~G~~~v~  100 (321)
                      ..+++++|+|||+.||+.    +.+|++|+++++|+|||+|+|+|++++|||+||++++|++|+..+++..+++|++.|+
T Consensus        16 ~~~~a~~~~VGd~~GW~~----~~~Y~~WA~~k~F~VGD~LvF~Y~~~~hnV~~V~~~~Y~~C~~~~pi~~~tsG~d~v~   91 (167)
T PLN03148         16 SATTATDHIVGANKGWNP----GINYTLWANNQTFYVGDLISFRYQKTQYNVFEVNQTGYDNCTTEGAAGNWTSGKDFIP   91 (167)
T ss_pred             hhccceEEEeCCCCCcCC----CCChhHhhcCCCCccCCEEEEEecCCCceEEEEChHHcCcccCCCCcceecCCCcEEE
Confidence            456778999999999984    3579999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccccEEEEecCccccccCceeEEEecCCC
Q 020799          101 LEAAGDYYFICTLELHCTLGQKLAIHVTGPA  131 (321)
Q Consensus       101 L~~~G~~yFic~~~~HC~~GmKl~I~V~~~~  131 (321)
                      |+++|++||||+ .+||++||||+|+|...+
T Consensus        92 L~~~G~~YFIcg-~ghC~~GmKl~I~V~~~~  121 (167)
T PLN03148         92 LNKAKRYYFICG-NGQCFNGMKVTILVHPLP  121 (167)
T ss_pred             ecCCccEEEEcC-CCccccCCEEEEEEcCCC
Confidence            999999999999 589999999999998643

>PLN03148 Blue copper-like protein; Provisional Back     alignment and domain information
>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PF02298 Cu_bind_like: Plastocyanin-like domain; InterPro: IPR003245 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR02656 cyanin_plasto plastocyanin Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR03102 halo_cynanin halocyanin domain Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>COG3794 PetE Plastocyanin [Energy production and conversion] Back     alignment and domain information
>TIGR02375 pseudoazurin pseudoazurin Back     alignment and domain information
>PRK02710 plastocyanin; Provisional Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR02657 amicyanin amicyanin Back     alignment and domain information
>TIGR03095 rusti_cyanin rusticyanin Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>PF00812 Ephrin: Ephrin; InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO) Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>TIGR03094 sulfo_cyanin sulfocyanin Back     alignment and domain information
>COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>TIGR02695 azurin azurin Back     alignment and domain information
>PF05283 MGC-24: Multi-glycosylated core protein 24 (MGC-24); InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PF07172 GRP: Glycine rich protein family; InterPro: IPR010800 This family consists of glycine rich proteins Back     alignment and domain information
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing Back     alignment and domain information
>PLN02354 copper ion binding / oxidoreductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 2e-22
1x9r_A116 Umecyanin From Horse Raddish- Crystal Structure Of 3e-13
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 6e-16
1ws7_A109 Crystal Structure Of Mavicyanin From Cucurbita Pepo 7e-09
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 1e-14
1jer_A138 Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 6e-08
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 4e-09
2cbp_A96 Cucumber Basic Protein, A Blue Copper Protein Lengt 3e-05
1f56_A91 Spinach Plantacyanin Length = 91 1e-06
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
Query: 30  VGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNPASPI 89
           VGGD+ W+ P      Y+TWA+ +TF VGD L F+F  G  DVA VTK+A++NC   +PI
Sbjct: 6   VGGDMEWKRPSDPKF-YITWATGKTFRVGDELEFDFAAGMHDVAVVTKDAFDNCKKENPI 64
Query: 90  SRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHV 127
           S  TT P +  L   G  Y+ICT+  HC +GQKL+I+V
Sbjct: 65  SHMTTPPVKIMLNTTGPQYYICTVGDHCRVGQKLSINV 102
>pdb|1X9R|A Chain A, Umecyanin From Horse Raddish- Crystal Structure Of The Oxidised Form Length = 116 Back     alignment and structure
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure
>pdb|1WS7|A Chain A, Crystal Structure Of Mavicyanin From Cucurbita Pepo Medullosa (Zucchini) Length = 109 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure
>pdb|1JER|A Chain A, Cucumber Stellacyanin, Cu2+, Ph 7.0 Length = 138 Back     alignment and structure
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|2CBP|A Chain A, Cucumber Basic Protein, A Blue Copper Protein Length = 96 Back     alignment and structure
>pdb|1F56|A Chain A, Spinach Plantacyanin Length = 91 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query321
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 3e-35
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 5e-31
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 3e-35
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 2e-32
2cbp_A96 Cucumber basic protein; electron transport, phytoc 1e-32
2cbp_A96 Cucumber basic protein; electron transport, phytoc 4e-27
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 1e-29
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 6e-26
1jer_A138 Cucumber stellacyanin; electron transport, copper, 7e-28
1jer_A138 Cucumber stellacyanin; electron transport, copper, 8e-28
1pk8_A 422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 6e-06
3dva_I 428 Dihydrolipoyllysine-residue acetyltransferase comp 4e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-04
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 5e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 4e-04
1pcx_A 810 Protein transport protein SEC24; 2.50A {Saccharomy 7e-04
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
 Score =  123 bits (309), Expect = 3e-35
 Identities = 40/107 (37%), Positives = 55/107 (51%), Gaps = 2/107 (1%)

Query: 26  TTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNP 85
           T H VG   GW         Y  WAS   F VGD LLFN+     +V  V +E +++CN 
Sbjct: 3   TVHKVGDSTGWTTLV--PYDYAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60

Query: 86  ASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHVTGPAP 132
           +SP +  T+G     L+  G +YF+C +  HC LGQK+ I V   + 
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKVDPGSS 107
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Length = 109 Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Length = 116 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Length = 96 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Length = 91 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 Back     alignment and structure
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Length = 810 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1jer_A138 Cucumber stellacyanin; electron transport, copper, 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
1ws8_A109 Mavicyanin; oxidized form, phytocyanin, cupredoxin 100.0
1x9u_A116 Umecyanin; cupredoxin, phytocyanin, copper binding 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
2cbp_A96 Cucumber basic protein; electron transport, phytoc 100.0
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 99.97
1f56_A91 Plantacyanin; cupredoxin, copper protein, beta bar 99.97
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.15
1qhq_A140 Protein (auracyanin); electron transfer, cupredoxi 99.13
2cal_A154 Rusticyanin; iron respiratory electron transport c 99.01
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.98
1bxv_A91 Plastocyanin; copper protein, electron transfer; 1 98.97
2cal_A154 Rusticyanin; iron respiratory electron transport c 98.91
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.73
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.72
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.71
1pmy_A123 Pseudoazurin; electron transfer(cuproprotein); 1.5 98.69
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.68
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.67
2aan_A139 Auracyanin A; cupredoxin fold, electron transport; 98.67
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.66
1paz_A123 Pseudoazurin precursor; electron transfer(cupropro 98.65
2gim_A106 Plastocyanin; beta sheet, Cu, helix, electron tran 98.65
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.62
1iuz_A98 Plastocyanin; electron transport; 1.60A {Ulva pert 98.61
1plc_A99 Plastocyanin; electron transport; 1.33A {Populus n 98.61
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.58
3erx_A123 Pseudoazurin; copper protein, high-resolution, E t 98.57
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.57
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.55
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.55
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.54
1b3i_A97 PETE protein, protein (plastocyanin); electron tra 98.52
3tu6_A127 Pseudoazurin (blue copper protein); cupredoxins, b 98.52
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.52
1byp_A99 Protein (plastocyanin); electron transfer, photosy 98.52
1kdj_A102 Plastocyanin; electron transfer, photosystem, PAI- 98.5
2plt_A98 Plastocyanin; electron transport; 1.50A {Chlamydom 98.49
3ef4_A124 Pseudoazurin, blue copper protein; electron transf 98.48
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.36
1pcs_A98 Plastocyanin; electron transport; 2.15A {Synechocy 98.34
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.96
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.92
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.85
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.82
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.81
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.81
3cvb_A105 Plastocyanin; cupredoxin, SELF assembly, copper, e 97.8
3ay2_A167 Lipid modified azurin protein; beta sandwich, bact 97.78
1cuo_A129 Protein (azurin ISO-2); beta barrel, periplasmic, 97.76
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 97.7
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.68
2ux6_A122 Pseudoazurin; type-1 copper, metal-binding, redox 97.67
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.66
2ov0_A105 Amicyanin; beta-sandwich, electron transport; 0.75 97.55
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.54
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.53
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.53
1nwp_A128 Azurin; electron transport, cupredoxin, electron t 97.5
3c75_A132 Amicyanin; copper proteins, electron transfer comp 97.5
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.49
2ccw_A129 Azurin II, AZN-2; electron transport (cuproprotein 97.46
1id2_A106 Amicyanin; beta barrel, type-1 blue copper protein 97.41
2iaa_C128 Azurin; quinoprotein, tryptophan tryptophylquinone 97.37
1oe1_A336 Dissimilatory copper-containing nitrite reductase; 97.33
2dv6_A447 Nitrite reductase; electron transfer, reduction, d 97.3
1iko_P178 Ephrin-B2; greek KEY, glycosylation, signaling pro 97.29
1mzy_A333 Copper-containing nitrite reductase; mutant M182T, 96.99
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 96.94
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 96.7
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 96.46
3gdc_A288 Multicopper oxidase; beta sandwich, plasmid, oxido 96.41
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 96.31
1shx_A138 Ephrin-A5; ephrin signaling, hormone-growth factor 96.24
3czu_B182 Ephrin-A1; ATP-binding, kinase, nucleotide-binding 96.15
2x11_B177 Ephrin-A5; receptor-signaling protein complex, dev 96.14
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 96.11
1iby_A112 Nitrosocyanin; RED copper, cupredoxin, beta hairpi 96.02
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 95.88
1kbv_A327 ANIA, major outer membrane protein PAN 1; ANIA[NO2 95.86
3d12_B141 Ephrin-B3; beta propeller, protein-receptor comple 95.6
2vsm_B140 Ephrin-B2; developmental protein, henipavirus, neu 95.41
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 95.06
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 95.04
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 95.03
2wo3_B157 Ephrin-A2; transferase-signaling protein complex, 94.92
3fsa_A125 Azurin; copper, cupredoxin fold, metal-binding, pr 94.9
2zoo_A442 Probable nitrite reductase; electron transfer, ele 94.76
2cua_A135 Protein (CUA); CUA center, electron transport; 1.6 94.72
3kw8_A276 Laccase, putative copper oxidase; two-domain lacca 94.5
2bw4_A340 Copper-containing nitrite reductase; oxidoreductas 94.14
2dv6_A 447 Nitrite reductase; electron transfer, reduction, d 93.33
3cg8_A343 Laccase; oxidoreductase, multicopper blue protein; 92.12
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 92.05
3g5w_A318 Multicopper oxidase type 1; two domain, laccase, n 91.92
1sdd_A306 Coagulation factor V; copper-binding protein, cofa 91.62
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 91.03
3hei_B132 Ephrin-A1; EPH receptor tyrosine kinase, cell memb 90.5
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 89.76
3tas_A313 Small laccase, multi-copper oxidase; two-domain la 89.62
3t9w_A299 Small laccase, multi-copper oxidase; two-domain co 89.14
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 87.69
2r7e_B 770 Coagulation factor VIII; ceruloplasmin fold, cuppe 87.3
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 87.27
3s8f_B168 Cytochrome C oxidase subunit 2; complex IV, respir 86.96
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 86.88
1sdd_B 647 Coagulation factor V; copper-binding protein, cofa 86.83
2zwn_A339 Two-domain type laccase; muticopper oxidase, oxido 86.39
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
Probab=100.00  E-value=8.1e-41  Score=284.98  Aligned_cols=109  Identities=32%  Similarity=0.563  Sum_probs=101.7

Q ss_pred             CceeeeecCccccccCCCCCcccccccccceeEeCCEEEEeecCCCCcEEEe-CccccccccCCCCcccccCCCeEEEe-
Q 020799          143 TPVNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIV-PKDVYETCNINSTIAVFTSSPVKITL-  220 (321)
Q Consensus       143 sa~~~~VGg~~gW~~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~h~V~~V-~~~~y~~C~~~~p~~~~~~G~~~v~L-  220 (321)
                      ++++|+|||+.||+++++ ..+|++||++++|+|||+|+|+|.+++|+|+|| ++++|+.|+.++++..+++|+++|+| 
T Consensus         2 ~a~~~~VGg~~GW~~~~~-~~~Y~~Wa~~~~F~vGD~LvF~y~~~~HsV~~V~~~~~y~~C~~s~p~~~~~~G~~~v~L~   80 (138)
T 1jer_A            2 QSTVHIVGDNTGWSVPSS-PNFYSQWAAGKTFRVGDSLQFNFPANAHNVHEMETKQSFDACNFVNSDNDVERTSPVIERL   80 (138)
T ss_dssp             CCCEEETTGGGCSSCCSS-TTHHHHHHHTCCEETTCEEEECCCTTTCCCEEESCHHHHHHTCCTTSCCCCCCCSCEEEEC
T ss_pred             CceEEEECCcCcCcCCCC-ccchhhhhcCCcCcCCCEEEEeecCCCceEEEeCchhhcCccCCCCccccccCCCeEEEec
Confidence            467899999999999754 468999999999999999999999999999999 99999999999999999999999999 


Q ss_pred             ecCeeEEEEcCCCCCCCCCCeEEEEEeCCCCC
Q 020799          221 KFPGEYYFTSTYLSHCSLGQRLAINVTGTSTP  252 (321)
Q Consensus       221 ~~~G~~yFic~~~~HC~~GmKl~I~V~~~~~~  252 (321)
                      +++|++||||++++||++||||+|+|.+...+
T Consensus        81 ~~~G~~YFicg~~gHC~~GmKl~I~V~~~~~~  112 (138)
T 1jer_A           81 DELGMHYFVCTVGTHCSNGQKLSINVVAANAT  112 (138)
T ss_dssp             CSSEEEEEECCSTTTGGGTCEEEEEEECCC--
T ss_pred             cCCcCEEEEcCCCCccccCCEEEEEEcCCCCC
Confidence            99999999999999999999999999987654
>1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>1ws8_A Mavicyanin; oxidized form, phytocyanin, cupredoxin, electron transport; 1.60A {Cucurbita pepo} SCOP: b.6.1.1 PDB: 1ws7_A Back     alignment and structure
>1x9u_A Umecyanin; cupredoxin, phytocyanin, copper binding site, beta barrel, electron transport; 1.80A {Armoracia rusticana} PDB: 1x9r_A Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>2cbp_A Cucumber basic protein; electron transport, phytocyanin, type 1 copper protein; 1.80A {Cucumis sativus} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1f56_A Plantacyanin; cupredoxin, copper protein, beta barrel, plant protein; 2.05A {Spinacia oleracea} SCOP: b.6.1.1 Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A Back     alignment and structure
>2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* Back     alignment and structure
>2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A Back     alignment and structure
>1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* Back     alignment and structure
>3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A Back     alignment and structure
>1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A Back     alignment and structure
>2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 Back     alignment and structure
>3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A Back     alignment and structure
>3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A Back     alignment and structure
>3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A Back     alignment and structure
>1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 Back     alignment and structure
>2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* Back     alignment and structure
>1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>1iko_P Ephrin-B2; greek KEY, glycosylation, signaling protein; HET: NAG MAN; 1.92A {Mus musculus} SCOP: b.6.1.5 Back     alignment and structure
>1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>1shx_A Ephrin-A5; ephrin signaling, hormone-growth factor complex; HET: NAG; 2.10A {Mus musculus} SCOP: b.6.1.5 PDB: 1shw_A* 3mx0_B* Back     alignment and structure
>3czu_B Ephrin-A1; ATP-binding, kinase, nucleotide-binding, receptor, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG MAN; 2.65A {Homo sapiens} PDB: 3mbw_B* Back     alignment and structure
>2x11_B Ephrin-A5; receptor-signaling protein complex, developmental protein, signaling platform, kinase, transferase, neurogenesis, receptor, cataract; 4.83A {Homo sapiens} Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Back     alignment and structure
>3d12_B Ephrin-B3; beta propeller, protein-receptor complex, envelope protein, glycoprotein, hemagglutinin, hydrolase, membrane, signal-AN transmembrane; HET: NAG BMA MAN BGC LXZ NGA GL0 GLC LXB NGZ GXL; 3.00A {Mus musculus} Back     alignment and structure
>2vsm_B Ephrin-B2; developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion; HET: NAG; 1.80A {Homo sapiens} PDB: 2wo2_B* 2i85_A 3gxu_B 2vsk_B 2hle_B 1kgy_E Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2wo3_B Ephrin-A2; transferase-signaling protein complex, EFN, EPHA4, KINA ephrin, complex, membrane, cell surface receptor, tyrosine- kinase, glycoprotein; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... Back     alignment and structure
>2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Back     alignment and structure
>2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* Back     alignment and structure
>3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* Back     alignment and structure
>2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Back     alignment and structure
>2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Back     alignment and structure
>3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Back     alignment and structure
>1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3hei_B Ephrin-A1; EPH receptor tyrosine kinase, cell membrane, disulfi glycoprotein, GPI-anchor, lipoprotein, membrane, ATP-bindin kinase; 2.00A {Homo sapiens} SCOP: b.6.1.0 Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* Back     alignment and structure
>3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Back     alignment and structure
>2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 321
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 2e-33
d1ws8a_104 b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) 6e-28
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 3e-32
d2cbpa_96 b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativ 7e-29
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 8e-30
d1jera_110 b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativ 2e-25
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 3e-28
d1f56a_91 b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia olera 3e-25
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure

class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Mavicyanin
species: Zucchini (Cucurbita pepo) [TaxId: 3663]

 Score =  117 bits (293), Expect = 2e-33
 Identities = 40/102 (39%), Positives = 54/102 (52%), Gaps = 2/102 (1%)

Query: 26  TTHVVGGDLGWQIPPGGAIAYVTWASMQTFSVGDILLFNFTTGQQDVASVTKEAYENCNP 85
           T H VG   GW         Y  WAS   F VGD LLFN+     +V  V +E +++CN 
Sbjct: 3   TVHKVGDSTGWTTLVPYD--YAKWASSNKFHVGDSLLFNYNNKFHNVLQVDQEQFKSCNS 60

Query: 86  ASPISRKTTGPAEFSLEAAGDYYFICTLELHCTLGQKLAIHV 127
           +SP +  T+G     L+  G +YF+C +  HC LGQK+ I V
Sbjct: 61  SSPAASYTSGADSIPLKRPGTFYFLCGIPGHCQLGQKVEIKV 102
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Length = 104 Back     information, alignment and structure
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 96 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Length = 110 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query321
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d2cbpa_96 Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d1ws8a_104 Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1jera_110 Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3 100.0
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.97
d1f56a_91 Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 99.96
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.82
d1bypa_99 Plastocyanin {White campion (Silene pratensis) [Ta 98.81
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.75
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.74
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.69
d2plta_98 Plastocyanin {Green alga (Chlamydomonas reinhardti 98.66
d1kdja_102 Plastocyanin {Fern (Adiantum capillus-veneris) [Ta 98.65
d1iuza_98 Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 98.64
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.61
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.6
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.59
d1adwa_123 Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 98.52
d2cj3a1105 Plastocyanin {Anabaena variabilis [TaxId: 1172]} 98.52
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.52
d1plca_99 Plastocyanin {Poplar (Populus nigra), variant ital 98.5
d1paza_120 Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta 98.5
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.48
d2jxma197 Plastocyanin {Photosynthetic prokaryote (Prochloro 98.48
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.46
d2q5ba1105 Plastocyanin {Cyanobacterium (Phormidium laminosum 98.41
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.4
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.4
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.37
d1bqka_124 Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 98.34
d1pmya_123 Pseudoazurin {Methylobacterium extorquens, strain 98.32
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.26
d1pcsa_98 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.25
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 98.22
d1qhqa_139 Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] 98.22
d1bxua_91 Plastocyanin {Cyanobacterium (Synechocystis sp.), 97.95
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.94
d2ov0a1105 Amicyanin {Paracoccus denitrificans [TaxId: 266]} 97.81
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.51
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.46
d1id2a_106 Amicyanin {Paracoccus versutus (Thiobacillus versu 97.39
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.39
d1cuoa_129 Azurin {Methylomonas sp. j [TaxId: 32038]} 97.28
d2ccwa1129 Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d 97.24
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 97.23
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 97.06
d1e30a_153 Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 96.74
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 96.38
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.32
d1nwpa_128 Azurin {Pseudomonas putida [TaxId: 303]} 96.21
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 96.14
d1shxa1138 Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} 95.88
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 95.87
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 95.66
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 95.5
d1ikop_141 Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 95.08
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 94.76
d1fwxa1132 Nitrous oxide reductase, C-terminal domain {Paraco 94.38
d2cuaa_122 Cytochrome c oxidase {Thermus thermophilus, ba3 ty 93.9
d1jzga_128 Azurin {Pseudomonas aeruginosa [TaxId: 287]} 93.74
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 93.63
d1qnia1131 Nitrous oxide reductase, C-terminal domain {Pseudo 93.62
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 93.38
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 93.3
d1kbva1151 Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani 93.09
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 92.93
d1aoza1129 Ascorbate oxidase {Zucchini (Cucurbita pepo var. m 92.28
d1oe2a1159 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 91.14
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 88.7
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 88.5
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 88.19
d1gyca1130 Laccase {Trametes versicolor, laccase 2 [TaxId: 53 87.85
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 86.18
d2bw4a1157 Nitrite reductase, NIR {Alcaligenes xylosoxidans [ 86.04
d1mzya1153 Nitrite reductase, NIR {Rhodobacter sphaeroides [T 84.47
d2q9oa1162 Laccase {Melanocarpus albomyces [TaxId: 204285]} 81.07
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
class: All beta proteins
fold: Cupredoxin-like
superfamily: Cupredoxins
family: Plastocyanin/azurin-like
domain: Plantacyanin
species: Cucumber (Cucumis sativus) [TaxId: 3659]

Probab=100.00  E-value=1.2e-36  Score=242.32  Aligned_cols=96  Identities=32%  Similarity=0.617  Sum_probs=92.2

Q ss_pred             eeeeecCccccccCCCCCcccccccccceeEeCCEEEEeecCCCCcEEEeCccccccccCCCCcccccCCCeEEEeecCe
Q 020799          145 VNYTVGGNIGWAIPPGGALFYASWASFYSFFVCDTLVFNFANGTQDVAIVPKDVYETCNINSTIAVFTSSPVKITLKFPG  224 (321)
Q Consensus       145 ~~~~VGg~~gW~~~~~~~~~Y~~Wa~~~~F~vGD~LvF~y~~~~h~V~~V~~~~y~~C~~~~p~~~~~~G~~~v~L~~~G  224 (321)
                      +.|+|||+.||++      +|++||++++|++||+|+|+|+++.|+|+||+|++|++|++++++..+++|+++|+|++ |
T Consensus         1 A~y~VGg~~GW~~------~y~~Wa~~~~F~vGD~LvF~y~~~~h~V~~V~~~~Y~~C~~~~~~~~~~~G~~~v~L~~-G   73 (96)
T d2cbpa_           1 AVYVVGGSGGWTF------NTESWPKGKRFRAGDILLFNYNPSMHNVVVVNQGGFSTCNTPAGAKVYTSGRDQIKLPK-G   73 (96)
T ss_dssp             CEEETTGGGCSCS------SCTTTTTTCCBCTTCEEEEECCTTTCCEEEECHHHHHHTCCCTTCEEECSSEEEEECCS-E
T ss_pred             CEEEcCCCCCCCc------CHHHHhCCCcEecCCEEEEecCCCCceEEEEChHHcCccCCCCCcccccCCCeEEEeCC-C
Confidence            4699999999986      49999999999999999999999999999999999999999999999999999999986 9


Q ss_pred             eEEEEcCCCCCCCCCCeEEEEEe
Q 020799          225 EYYFTSTYLSHCSLGQRLAINVT  247 (321)
Q Consensus       225 ~~yFic~~~~HC~~GmKl~I~V~  247 (321)
                      ++||||+.++||++||||+|+|+
T Consensus        74 ~~YFic~~~~hC~~G~Kl~V~Vl   96 (96)
T d2cbpa_          74 QSYFICNFPGHCQSGMKIAVNAL   96 (96)
T ss_dssp             EEEEECCSTTTGGGTCEEEEEEC
T ss_pred             CCEEEeCCCCcCcCCCEEEEEEC
Confidence            99999999999999999999995
>d2cbpa_ b.6.1.1 (A:) Plantacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d1ws8a_ b.6.1.1 (A:) Mavicyanin {Zucchini (Cucurbita pepo) [TaxId: 3663]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1jera_ b.6.1.1 (A:) Stellacyanin {Cucumber (Cucumis sativus) [TaxId: 3659]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1f56a_ b.6.1.1 (A:) Plantacyanin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} Back     information, alignment and structure
>d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} Back     information, alignment and structure
>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} Back     information, alignment and structure
>d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} Back     information, alignment and structure
>d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1shxa1 b.6.1.5 (A:32-170) Ephrin-a5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ikop_ b.6.1.5 (P:) Ephrin-b2 ectodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} Back     information, alignment and structure
>d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Back     information, alignment and structure
>d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Back     information, alignment and structure