Citrus Sinensis ID: 020825


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-
MADKPSKALVLYGDGLARFVEPSHAHLHSLASKAACGFLSLPIAPPSESEEERIVREFAVLIDANQDYLSGIGEHTTELKWEEKSPFQTISDRFMGLKAALITTNSRLKSFGDKLGFATLQLNELIETSDSLSGSPIDVVASELLKLLGLQRGKMEEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQMAQPATEVGSRLHLSVVLSYGQVLEADNSNLSVLISIDEKSSDLSALFPRQSYTMKGETPRNDVRHHCPMLISQWQYAVTRKDMAETFSFKDFKEHGGYLTIPADRFLHEVAFKLWKAPKYGA
cccccccEEEEEccccccccccccccHHHHHHHccccCECcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHccccHHHHHcccccccccccccccEEEEHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEEEEEccHHHcccccccEEEccccccccccccccccccCECccccccccccccccEEEEEEccccccccccccccHHHHHHccccccccHHHHHHHHHHHHcccccccc
****PSK*LVLYGDGLARFVEPSHAHLHSLASKAACGFLSLPI*********RIVREFAVLIDANQDYLSGIG*HTTELKW*EKSPFQTISDRFMGLKAALITTNSRLKSFGDKLGFATLQLNELIETSDSLSGSPIDVVASELLKLLGLQRGKMEEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQMAQPATEVGSRLHLSVVLSYGQVLEADNSNLSVLISID*********FPRQSYTMKGETPRNDVRHHCPMLISQWQYAVTRKDMAETFSFKDFKEHGGYLTIPADRFLHEVAFKLWKAPKYG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADKPSKALVLYGDGLARFVEPSHAHLHSLASKAACGFLSLPIAPPSESEEERIVREFAVLIDANQDYLSGIGEHTTELKWEEKSPFQTISDRFMGLKAALITTNSRLKSFGDKLGFATLQLNELIETSDSLSGSPIDVVASELLKLLGLQRGKMEEVSQFDLVLVHIGAGEKTNDDKGKAVAHDLEYINALVRVILQMAQPATEVGSRLHLSVVLSYGQVLEADNSNLSVLISIDEKSSDLSALFPRQSYTMKGETPRNDVRHHCPMLISQWQYAVTRKDMAETFSFKDFKEHGGYLTIPADRFLHEVAFKLWKAPKYGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKT, chain A
Confidence level:confident
Coverage over the Query: 83-148,159-227,238-240,252-321
View the alignment between query and template
View the model in PyMOL
Template: 3LXQ, chain A
Confidence level:probable
Coverage over the Query: 3-228,252-286,297-316
View the alignment between query and template
View the model in PyMOL
Template: 3TG0, chain A
Confidence level:probable
Coverage over the Query: 135-286,297-314
View the alignment between query and template
View the model in PyMOL