Citrus Sinensis ID: 020854


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYSVYAATKAYIDQFSRSLYVEYRKSGIDVQCQVPLYVATKMASIKRSSFFVPSTDVYARAAMRWIGYEPCCTPYWPHSFIWGVLSILPEKLIDAGRLQFSIGIRKRGQLKDARKKE
ccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccccHHHHHHHHHHHccccEEEECccHHHHHHHHHHHHHHHccEEEEEEEEccccccHHHHHHHHHHHccccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHccccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccHHHHHHHHHHHcccccEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
***CFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYSVYAATKAYIDQFSRSLYVEYRKSGIDVQCQVPLYVATKMASIKRSSFFVPSTDVYARAAMRWIGYEPCCTPYWPHSFIWGVLSILPEKLIDAGRLQFSIGIR************
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESCFLNTLKTQPLWLLALFTIGSLSVLRLAFVILNWVYVNFLRPAKNLRKYGSWALVTGPTDGIGKSFAFQLAKTGLNLVLVGRNPDKLKDVSDSIQAKYAKTQIKSVVVDFSGDLDEGVERIKEAIEGLDVGVLINNVGISYPYARFFHEVDQVLLKNLIKVNVEGTTKVTQAVLPGMLKRKKGAIVNIGSGAAIVIPSDPLYSVYAATKAYIDQFSRSLYVEYRKSGIDVQCQVPLYVATKMASIKRSSFFVPSTDVYARAAMRWIGYEPCCTPYWPHSFIWGVLSILPEKLIDAGRLQFSIGIRKRGQLKDARKKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Very-long-chain 3-oxoacyl-CoA reductase 1 Beta-ketoacyl-coenzyme A reductase required for the elongation of fatty acids precursors of sphingolipids, triacylglycerols, cuticular waxes and suberin. Responsible for the first reduction step in very long-chain fatty acids (VLCFAs) synthesis. Decreased expression of KCR1 (RNAi) leads to plants with fused vegetative and reproductive organs, and abnormal trichome, epidermal cell and root morphology. Cannot be complemented by KCR2.probableQ8L9C4
Very-long-chain 3-oxoacyl-CoA reductase Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids.probableA2QCH3
Estradiol 17-beta-dehydrogenase 12 Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation.probableQ28IU1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 49-271
View the alignment between query and template
View the model in PyMOL
Template: 1YB1, chain A
Confidence level:very confident
Coverage over the Query: 47-291
View the alignment between query and template
View the model in PyMOL