Citrus Sinensis ID: 020889


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MGFDLESLSDATSGAIGALVSTTILYPLDTCKTKYQAEVRARHQQKYRNISDVLWEAISTRQVLSLYQGLGTKNLQSFISQFIYFYGYSFFKRLYLQKSGNKSIGTRANLIVAAAAGACTVIVTQPLDTASSRMQTSEFGKSKGLWKSLSESTWSEAFDGLGISLLLTSNPSIQYTVFDQLKQRLLRRRLKRETGKEPSPEALPAFSAFFLGALSKCVATFLTYPAIRCKVMLQAAESDEDGINQAPQRNKNTVSDALCSIWKREGPLGFYKGIQAQILKTVLSSALLLMIKEKITKTSWVLLLALQKILSTTHGRLKSA
ccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccHHHHHHHHHHHHHcHHHHHHHHcccccccccHHHHHHHHHHHHHHHcHcccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
***DLESLSDATSGAIGALVSTTILYPLDTCKTKYQAEVRARHQQKYRNISDVLWEAISTRQVLSLYQGLGTKNLQSFISQFIYFYGYSFFKRLYLQKSGNKSIGTRANLIVAAAAGACTVIVTQPLDTASSR*************KSLSESTWSEAFDGLGISLLLTSNPSIQYTVFDQLKQRLLR***************LPAFSAFFLGALSKCVATFLTYPAIRCKVMLQA****************NTVSDALCSIWKREGPLGFYKGIQAQILKTVLSSALLLMIKEKITKTSWVLLLALQKILS*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFDLESLSDATSGAIGALVSTTILYPLDTCKTKYQAEVRARHQQKYRNISDVLWEAISTRQVLSLYQGLGTKNLQSFISQFIYFYGYSFFKRLYLQKSGNKSIGTRANLIVAAAAGACTVIVTQPLDTASSRMQTSEFGKSKGLWKSLSESTWSEAFDGLGISLLLTSNPSIQYTVFDQLKQRLLRRRLKRETGKEPSPEALPAFSAFFLGALSKCVATFLTYPAIRCKVMLQAAESDEDGINQAPQRNKNTVSDALCSIWKREGPLGFYKGIQAQILKTVLSSALLLMIKEKITKTSWVLLLALQKILSTTHGRLKSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal adenine nucleotide carrier 1 Peroxisomal adenine nucleotide transporter catalyzing the counterexchange of ATP with AMP. ATP is needed by reactions that generate acyl-CoA for peroxisomal fatty acid beta-oxidation during postgerminative growth. Required for the beta-oxidation reactions involved in auxin biosynthesis and for the conversion of seed-reserved triacylglycerols into sucrose that is necessary for growth before the onset of photosynthesis.probableQ9MA90
Peroxisomal adenine nucleotide carrier 1 Peroxisomal adenine nucleotide transporter catalyzing the counterexchange of ATP with AMP. ATP is needed by reactions that generate acyl-CoA for peroxisomal fatty acid beta-oxidation during postgerminative growth. Required for the conversion of seed-reserved triacylglycerols into sucrose that is necessary for growth before the onset of photosynthesis.probableB6ZJZ9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 4-188,201-295
View the alignment between query and template
View the model in PyMOL