Citrus Sinensis ID: 020901

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320

MREIDLGAHTIKSHGARVARNHLHDWIILLLLAVIEVVLYVIHPFYRFVGEDMMTDLKYPFKDNTVPIWAVPMYAVLLPIAIFLLCYLRRRDVYDLHHGILGLLYAVLITGVITDAIKNATGRPRPNFFWRCFPDGVPNYGGHWGDVVCHGKDSEVREGHKSFPSGHTSWSFAGLGFLSLYLSGKIKAFDGRGHVAKLCIVLLPLLVASLVGVSRVSDYWHHWQDVFAGGMIGLVVATLCYLQFFPPPHYDDGWGPYAYFRAREESHSNNMGHSRNSVNALEMEIHSVNQRTEPNGDAFLPVYANSPPSSTLDEMESGRR

ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEcccHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*********TIKSHGARVARNHLHDWIILLLLAVIEVVLYVIHPFYRFVGEDMMTDLKYPFKDNTVPIWAVPMYAVLLPIAIFLLCYLRRRDVYDLHHGILGLLYAVLITGVITDAIKNATGRPRPNFFWRCFPDGVPNYGGHWGDVVCHGKDSEVREGHKSFPSGHTSWSFAGLGFLSLYLSGKIKAFDGRGHVAKLCIVLLPLLVASLVGVSRVSDYWHHWQDVFAGGMIGLVVATLCYLQFFPPPHYDDGWGPYAYFR***********************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable diacylglycerol pyrophosphate phosphatase 1	Catalyzes the dephosphorylation of diacylglycerol phosphate (DGPP) to phosphatidate (PA) and the subsequent dephosphorylation of PA to diacylglycerol (DAG).	probable	Q9UUA6

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IPB, chain A
Confidence level:very confident
Coverage over the Query: 112-131,146-185,196-241
View the alignment between query and template
View the model in PyMOL

Template: 1QI9, chain A
Confidence level:confident
Coverage over the Query: 114-245
View the alignment between query and template
View the model in PyMOL