Citrus Sinensis ID: 020931


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MELQQKFYGIFKGTVEKITSHRTVSAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGEPSKRKSYLPADKQFLITRNVPCLRRAASVEEEYEGAGGEILVDNEDNDGWLATHGKPKAKCDEDEDDNLPSMEAVEISKNNNVRAISTYFGGEEEEEEDIPDMAEYNEPDSIIENETDPATLPSTYLVAHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDESRMLLKTELILEDVSQDHARKTVTIEDHPHLTGKHASIHPCRHGAVMKKIIDVLVSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSN
cHHHHHHHHHHHHHHEEcccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccEEEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEECccccccEEEEEEEccccccccHHHHHHHcccccccccEEEcccccccccccCCccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccEEEEcccEEECccccc
*****KFYGIFKGTVEKITSHRTVSAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGEPSKRKSYLPADKQFLITRNVPCLRRAASVEEEYEGAGGEILVDNEDNDGWLATHG********************************************IPDMAEYNEPDSIIENETDPATLPSTYLVAHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDESRMLLKTELILEDVSQDHARKTVTIEDHPHLTGKHASIHPCRHGAVMKKIIDVLVSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLG****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELQQKFYGIFKGTVEKITSHRTVSAFKEKGVLSVSEFVLAGDNLVSKCPTWSWESGEPSKRKSYLPADKQFLITRNVPCLRRAASVEEEYEGAGGEILVDNEDNDGWLATHGKPKAKCDEDEDDNLPSMEAVEISKNNNVRAISTYFGGEEEEEEDIPDMAEYNEPDSIIENETDPATLPSTYLVAHEPDDDNILRTRTYDISITYDKYYQTPRVWLTGYDESRMLLKTELILEDVSQDHARKTVTIEDHPHLTGKHASIHPCRHGAVMKKIIDVLVSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Autophagy-related protein 3 E2 conjugating enzyme responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt).confidentQ0WWQ1
Ubiquitin-like-conjugating enzyme ATG3 E2-like enzyme involved in autophagy and mitochondrial homeostasis. Catalyzes the conjugation of atg8-like proteins (gabarap, gabarapl1, gabarapl2 or map1lc3a) to phosphatidylethanolamine (PE). PE-conjugation to atg8-like proteins is essential for autophagy. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of atg12 to itself, atg12 conjugation to atg3 playing a role in mitochondrial homeostasis but not in autophagy.probableQ5I0S6
Autophagy-related protein 3 Putative E2-like conjugating enzyme involved in autophagy and for the cytoplasm to vacuole transport (Cvt).probableO43035

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VX8, chain B
Confidence level:very confident
Coverage over the Query: 196-310
View the alignment between query and template
View the model in PyMOL
Template: 2DYT, chain A
Confidence level:very confident
Coverage over the Query: 26-87,127-131,151-159,195-309
View the alignment between query and template
View the model in PyMOL