Citrus Sinensis ID: 020962


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MTNIRFSFDRKDFVTEAKLCFVFYREMASKIWILLLGILFMVSATMGVPPRKPVNVPFGRNYMPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGSVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKAYHFYSVLWNMYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYKGFHIDGCEASVQAKYCATQGKRWWDQKEFQDLDAFQYRRLKWVRSKFTIYNYCTDRSRFPVLPPECRRDRDI
ccccEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEccccEEEEEEccccccCEECccCEEEEEEEEEEEECcccccCEEEEEEEEcccccccEEEEEECcccccccEEEEEEEEEccccccCEEEEcccccccccEEEEEEEcccEEEEEEccCEEEEEEcccccccccccccccEEEEcccccccccccccCEEcccccccEEEEEEEEEEECcccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEECcccccccccccccccccc
***IRFSFDRKDFVTEAKLCFVFYREMASKIWILLLGILFMVSATMGVPPRKPVNVPFGRNYMPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGSVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKAYHFYSVLWNMYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYKGFHIDGCEASVQAKYCAT*GKRWWDQKEFQDLDAFQYRRLKWVRSKFTIYNYCTDRSRFPVLPPECR*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNIRFSFDRKDFVTEAKLCFVFYREMASKIWILLLGILFMVSATMGVPPRKPVNVPFGRNYMPTWAFDHIKYFNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMQMKLVPGDSAGSVTAFYLSSQNSEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTKAYHFYSVLWNMYQIVFFVDDIPIRVFKNCKDLGVRFPFNQPMKIYSSLWNADDWATRGGLEKTDWSKAPFIASYKGFHIDGCEASVQAKYCATQGKRWWDQKEFQDLDAFQYRRLKWVRSKFTIYNYCTDRSRFPVLPPECRRDRDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable xyloglucan endotransglucosylase/hydrolase protein 5 Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.confidentQ9XIW1
Probable xyloglucan endotransglucosylase/hydrolase protein Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableP93349
Xyloglucan endotransglucosylase/hydrolase protein A Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.probableQ41638

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.207Xyloglucan:xyloglucosyl transferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMZ, chain A
Confidence level:very confident
Coverage over the Query: 55-318
View the alignment between query and template
View the model in PyMOL
Template: 2VH9, chain A
Confidence level:confident
Coverage over the Query: 58-313
View the alignment between query and template
View the model in PyMOL