Citrus Sinensis ID: 020988


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MAIAAAAASSSSSLFPKYPCLSRNSPRLPQSLRFSSTIRAVTLQPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGLTLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERGWRQNFNRSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAASVFSSSYSLLSICYLLQFRYTKIIELDNDNLILHPRRGQVNNSGQEPGTAVFFERVVLETYS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEEEcccccHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHccccccccEEEEEccccccccccccccHHEEcccccccccHHHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccccccccccccccEEEEEEEEEcccc
*****************************************************LELEGDLFSCPICYEPLIRKGPTGLTLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERGWRQNFNRSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAASVFSSSYSLLSICYLLQFRYTKIIELDNDNLILHPRRGQVNNSGQEPGTAVFFERVVLE***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIAAAAASSSSSLFPKYPCLSRNSPRLPQSLRFSSTIRAVTLQPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGLTLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERGWRQNFNRSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAASVFSSSYSLLSICYLLQFRYTKIIELDNDNLILHPRRGQVNNSGQEPGTAVFFERVVLETYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized methyltransferase At2g41040, chloroplastic probableQ0WPT7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1P91, chain A
Confidence level:very confident
Coverage over the Query: 61-74,86-128,140-277
View the alignment between query and template
View the model in PyMOL
Template: 3FPF, chain A
Confidence level:confident
Coverage over the Query: 131-274
View the alignment between query and template
View the model in PyMOL
Template: 3VYW, chain A
Confidence level:probable
Coverage over the Query: 165-297
View the alignment between query and template
View the model in PyMOL