Citrus Sinensis ID: 020988
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 319 | ||||||
| 363814481 | 341 | uncharacterized protein LOC100798970 [Gl | 0.764 | 0.715 | 0.733 | 1e-102 | |
| 225463049 | 343 | PREDICTED: uncharacterized methyltransfe | 0.796 | 0.740 | 0.720 | 1e-102 | |
| 356556565 | 341 | PREDICTED: uncharacterized methyltransfe | 0.764 | 0.715 | 0.717 | 1e-100 | |
| 225463051 | 340 | PREDICTED: uncharacterized methyltransfe | 0.799 | 0.75 | 0.711 | 1e-100 | |
| 224142467 | 332 | predicted protein [Populus trichocarpa] | 0.774 | 0.743 | 0.694 | 1e-100 | |
| 296084557 | 338 | unnamed protein product [Vitis vinifera] | 0.789 | 0.745 | 0.715 | 1e-99 | |
| 224120260 | 308 | predicted protein [Populus trichocarpa] | 0.670 | 0.694 | 0.796 | 2e-99 | |
| 255581285 | 290 | phosphatidylethanolamine n-methyltransfe | 0.645 | 0.710 | 0.820 | 7e-99 | |
| 388516609 | 342 | unknown [Medicago truncatula] | 0.764 | 0.713 | 0.713 | 4e-98 | |
| 217072446 | 342 | unknown [Medicago truncatula] | 0.764 | 0.713 | 0.713 | 5e-98 |
| >gi|363814481|ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max] gi|255636913|gb|ACU18789.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 377 bits (967), Expect = e-102, Method: Compositional matrix adjust.
Identities = 182/248 (73%), Positives = 210/248 (84%), Gaps = 4/248 (1%)
Query: 15 FPKYPCLSRNSPRLPQSLRFSS--TIRAVTLQPAKSE--RNQTLELEGDLFSCPICYEPL 70
F K P LS S P+ LR S TIRA++ A+SE Q +E D+F+CP+CYEPL
Sbjct: 19 FSKCPRLSSKSHFRPRLLRSISQRTIRAISAVAAESELGTQQDHAIEADIFACPVCYEPL 78
Query: 71 IRKGPTGLTLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPF 130
IRKGP+GL L AIYRSGF C++C KTYSSKD YLDLTV +GL+DYTE++PA TELFRSP
Sbjct: 79 IRKGPSGLNLPAIYRSGFMCKRCKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPL 138
Query: 131 VSFLYERGWRQNFNRSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTY 190
VSFL+ERGWRQNF +SGFPGPDEEFKMAQEYF+SA+GGLLVDVSCGSGLFSRKFAKSGTY
Sbjct: 139 VSFLHERGWRQNFRQSGFPGPDEEFKMAQEYFESAEGGLLVDVSCGSGLFSRKFAKSGTY 198
Query: 191 SGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCW 250
SGV+ALDFSENMLRQCYDFI++D+ + T+N+ALVRADV RLPF+SG VDAVHAGAALHCW
Sbjct: 199 SGVIALDFSENMLRQCYDFIEKDDALSTNNIALVRADVSRLPFSSGSVDAVHAGAALHCW 258
Query: 251 PSPSNAAS 258
PSPSNA +
Sbjct: 259 PSPSNAVA 266
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225463049|ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic [Vitis vinifera] gi|296084558|emb|CBI25579.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356556565|ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225463051|ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224142467|ref|XP_002324579.1| predicted protein [Populus trichocarpa] gi|222866013|gb|EEF03144.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|296084557|emb|CBI25578.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224120260|ref|XP_002331004.1| predicted protein [Populus trichocarpa] gi|222872934|gb|EEF10065.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255581285|ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus communis] gi|223528947|gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388516609|gb|AFK46366.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|217072446|gb|ACJ84583.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 319 | ||||||
| TAIR|locus:2063218 | 352 | AT2G41040 [Arabidopsis thalian | 0.683 | 0.619 | 0.707 | 1e-82 | |
| TAIR|locus:2194759 | 355 | AT1G78140 [Arabidopsis thalian | 0.630 | 0.566 | 0.543 | 1.4e-55 | |
| UNIPROTKB|G5EGY9 | 380 | MGCH7_ch7g116 "Sterol 24-C-met | 0.347 | 0.292 | 0.314 | 0.00056 |
| TAIR|locus:2063218 AT2G41040 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 829 (296.9 bits), Expect = 1.0e-82, P = 1.0e-82
Identities = 157/222 (70%), Positives = 182/222 (81%)
Query: 33 RFSSTIRAVTLQPAKSERNQT--LELEG-DLFSCPICYEPLIRKGPTGLTLGAIYRSGFK 89
RF S + + +N+T +E+E +F+CP+CYEPL+RKGP+G+ L AIYRSGFK
Sbjct: 48 RFPSAAISAVAPKSDINKNETPKIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFK 107
Query: 90 CRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERGWRQNFNRSGFP 149
C +C+KTYSSKD YLDLTV + L DY EVKP +TELFRSP VSFLYERGWRQ F RSGFP
Sbjct: 108 CGQCNKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWRQAFKRSGFP 167
Query: 150 GPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDF 209
GPDEEF+MA+EYFK A+GGLLVDVSCGSGLFSRKFA+SG YSGV+ALD+SENMLRQC +F
Sbjct: 168 GPDEEFRMAEEYFKEAEGGLLVDVSCGSGLFSRKFAQSGKYSGVIALDYSENMLRQCKEF 227
Query: 210 IKQDNTILTS-NLALVRADVCRLPFASGFVDAVHAGAALHCW 250
IK DNT S N+A+VRADV RLPF SG VDAVHAGAALHCW
Sbjct: 228 IKNDNTFDNSTNIAVVRADVSRLPFPSGSVDAVHAGAALHCW 269
|
|
| TAIR|locus:2194759 AT1G78140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5EGY9 MGCH7_ch7g116 "Sterol 24-C-methyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00005656001 | SubName- Full=Chromosome undetermined scaffold_155, whole genome shotgun sequence; (343 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 319 | |||
| pfam08241 | 92 | pfam08241, Methyltransf_11, Methyltransferase doma | 2e-13 | |
| PRK00216 | 239 | PRK00216, ubiE, ubiquinone/menaquinone biosynthesi | 1e-10 | |
| TIGR02072 | 240 | TIGR02072, BioC, biotin biosynthesis protein BioC | 7e-10 | |
| PRK08317 | 241 | PRK08317, PRK08317, hypothetical protein; Provisio | 1e-08 | |
| TIGR01934 | 223 | TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone | 5e-08 | |
| pfam08242 | 98 | pfam08242, Methyltransf_12, Methyltransferase doma | 2e-07 | |
| COG2226 | 238 | COG2226, UbiE, Methylase involved in ubiquinone/me | 2e-07 | |
| pfam12847 | 104 | pfam12847, Methyltransf_18, Methyltransferase doma | 3e-07 | |
| pfam13649 | 97 | pfam13649, Methyltransf_25, Methyltransferase doma | 5e-06 | |
| cd02440 | 107 | cd02440, AdoMet_MTases, S-adenosylmethionine-depen | 2e-04 | |
| PRK05785 | 226 | PRK05785, PRK05785, hypothetical protein; Provisio | 5e-04 | |
| TIGR02752 | 231 | TIGR02752, MenG_heptapren, demethylmenaquinone met | 9e-04 | |
| pfam01209 | 233 | pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransf | 0.002 | |
| PLN02233 | 261 | PLN02233, PLN02233, ubiquinone biosynthesis methyl | 0.003 |
| >gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain | Back alignment and domain information |
|---|
Score = 65.0 bits (159), Expect = 2e-13
Identities = 25/86 (29%), Positives = 32/86 (37%), Gaps = 10/86 (11%)
Query: 171 VDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCR 230
+DV CG+GL + A+ G V +D S ML + V D
Sbjct: 1 LDVGCGTGLLAEALARRGGAR-VTGVDLSPEMLALARKR---------APRKFVVGDAED 50
Query: 231 LPFASGFVDAVHAGAALHCWPSPSNA 256
LPF D V + LH P P A
Sbjct: 51 LPFPDESFDVVVSSLVLHHLPDPERA 76
|
Members of this family are SAM dependent methyltransferases. Length = 92 |
| >gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233708 TIGR02072, BioC, biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233645 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >gnl|CDD|235607 PRK05785, PRK05785, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131799 TIGR02752, MenG_heptapren, demethylmenaquinone methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family | Back alignment and domain information |
|---|
| >gnl|CDD|177877 PLN02233, PLN02233, ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 319 | |||
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.92 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 99.9 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.9 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 99.85 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.83 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.77 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 99.77 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 99.75 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 99.73 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 99.73 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 99.71 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 99.71 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 99.7 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 99.7 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 99.68 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 99.68 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 99.66 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 99.66 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 99.65 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 99.64 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 99.64 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 99.63 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 99.63 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 99.63 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 99.62 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 99.62 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 99.62 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.62 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 99.62 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 99.61 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 99.61 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 99.6 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 99.6 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 99.6 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 99.59 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 99.59 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 99.57 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 99.57 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 99.56 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 99.55 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 99.55 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 99.55 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 99.54 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 99.54 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 99.54 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 99.53 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 99.53 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 99.52 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 99.51 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 99.51 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 99.5 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 99.49 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 99.48 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 99.48 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 99.48 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 99.48 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 99.47 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 99.47 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.45 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 99.45 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 99.44 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 99.44 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 99.44 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 99.43 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 99.43 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 99.41 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 99.41 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 99.41 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 99.41 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 99.4 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 99.4 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 99.4 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 99.39 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 99.38 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 99.37 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 99.35 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 99.33 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 99.32 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 99.31 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 99.3 | |
| PRK04266 | 226 | fibrillarin; Provisional | 99.3 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 99.3 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 99.3 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 99.3 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 99.3 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 99.26 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 99.24 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 99.24 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 99.23 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 99.23 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 99.23 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 99.22 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 99.22 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 99.2 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 99.2 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 99.19 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 99.19 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 99.19 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 99.18 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 99.17 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 99.17 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 99.17 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 99.14 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 99.12 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 99.11 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 99.11 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 99.1 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 99.1 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 99.1 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 99.09 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 99.08 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 99.08 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 99.07 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 99.07 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 99.07 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 99.06 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 99.02 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 99.02 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 99.01 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 99.01 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 99.0 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 99.0 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 98.99 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 98.99 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.98 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 98.97 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 98.97 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 98.96 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.96 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 98.95 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 98.95 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 98.94 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 98.93 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 98.92 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.91 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 98.9 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 98.88 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 98.88 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 98.87 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 98.84 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 98.84 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 98.82 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 98.81 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 98.81 | |
| KOG1500 | 517 | consensus Protein arginine N-methyltransferase CAR | 98.8 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 98.8 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 98.8 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 98.8 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 98.78 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 98.76 | |
| PLN02366 | 308 | spermidine synthase | 98.75 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 98.75 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 98.72 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 98.71 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 98.69 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 98.68 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 98.66 | |
| PLN02476 | 278 | O-methyltransferase | 98.66 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 98.64 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 98.64 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 98.63 | |
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 98.63 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.62 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 98.62 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 98.62 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 98.61 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 98.61 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 98.6 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 98.57 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 98.57 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 98.56 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 98.54 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 98.54 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 98.54 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 98.48 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 98.48 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 98.48 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 98.48 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 98.47 | |
| KOG1269 | 364 | consensus SAM-dependent methyltransferases [Lipid | 98.46 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 98.44 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 98.44 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 98.43 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 98.42 | |
| KOG1331 | 293 | consensus Predicted methyltransferase [General fun | 98.4 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 98.4 | |
| KOG0820 | 315 | consensus Ribosomal RNA adenine dimethylase [RNA p | 98.35 | |
| PLN02823 | 336 | spermine synthase | 98.33 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 98.31 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 98.31 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 98.28 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 98.27 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 98.27 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 98.26 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 98.26 | |
| KOG3191 | 209 | consensus Predicted N6-DNA-methyltransferase [Tran | 98.18 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 98.17 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 98.17 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 98.16 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 98.15 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 98.12 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 98.11 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 98.11 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 98.09 | |
| PRK11827 | 60 | hypothetical protein; Provisional | 98.09 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 98.08 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 98.08 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 98.07 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 98.07 | |
| COG2835 | 60 | Uncharacterized conserved protein [Function unknow | 98.06 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 98.06 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 98.04 | |
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 98.02 | |
| KOG2915 | 314 | consensus tRNA(1-methyladenosine) methyltransferas | 98.02 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 98.01 | |
| KOG2352 | 482 | consensus Predicted spermine/spermidine synthase [ | 97.98 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 97.95 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 97.93 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 97.93 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 97.92 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 97.91 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 97.86 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 97.82 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 97.81 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 97.8 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 97.8 | |
| KOG1663 | 237 | consensus O-methyltransferase [Secondary metabolit | 97.78 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 97.76 | |
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 97.76 | |
| KOG2187 | 534 | consensus tRNA uracil-5-methyltransferase and rela | 97.73 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 97.72 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 97.72 | |
| PF03966 | 68 | Trm112p: Trm112p-like protein; InterPro: IPR005651 | 97.69 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 97.65 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 97.56 | |
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 97.55 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 97.53 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 97.53 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 97.52 | |
| KOG3987 | 288 | consensus Uncharacterized conserved protein DREV/C | 97.52 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 97.4 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 97.34 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 97.31 | |
| KOG3115 | 249 | consensus Methyltransferase-like protein [General | 97.21 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 97.2 | |
| KOG1709 | 271 | consensus Guanidinoacetate methyltransferase and r | 97.17 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 97.14 | |
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 97.11 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 97.09 | |
| KOG4058 | 199 | consensus Uncharacterized conserved protein [Funct | 97.05 | |
| KOG3201 | 201 | consensus Uncharacterized conserved protein [Funct | 97.01 | |
| PF05971 | 299 | Methyltransf_10: Protein of unknown function (DUF8 | 97.0 | |
| KOG4589 | 232 | consensus Cell division protein FtsJ [Cell cycle c | 96.93 | |
| PF07091 | 251 | FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: | 96.91 | |
| PF01269 | 229 | Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr | 96.86 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 96.75 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 96.71 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 96.66 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 96.56 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 96.54 | |
| PRK09678 | 72 | DNA-binding transcriptional regulator; Provisional | 96.42 | |
| KOG2798 | 369 | consensus Putative trehalase [Carbohydrate transpo | 96.36 | |
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 96.19 | |
| PF04445 | 234 | SAM_MT: Putative SAM-dependent methyltransferase; | 96.07 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 96.03 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 95.96 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 95.9 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 95.85 | |
| COG0286 | 489 | HsdM Type I restriction-modification system methyl | 95.85 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 95.77 | |
| PRK00420 | 112 | hypothetical protein; Validated | 95.73 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 95.7 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 95.58 | |
| PRK13699 | 227 | putative methylase; Provisional | 95.55 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 95.55 | |
| PF04989 | 206 | CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 | 95.37 | |
| COG4798 | 238 | Predicted methyltransferase [General function pred | 95.19 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 95.14 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 95.11 | |
| COG4627 | 185 | Uncharacterized protein conserved in bacteria [Fun | 95.11 | |
| PF14803 | 34 | Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. | 95.07 | |
| KOG1501 | 636 | consensus Arginine N-methyltransferase [General fu | 94.91 | |
| COG1889 | 231 | NOP1 Fibrillarin-like rRNA methylase [Translation, | 94.9 | |
| PHA00626 | 59 | hypothetical protein | 94.88 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 94.65 | |
| PHA01634 | 156 | hypothetical protein | 94.54 | |
| PF06962 | 140 | rRNA_methylase: Putative rRNA methylase; InterPro: | 94.47 | |
| PF08792 | 33 | A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I | 94.43 | |
| COG1997 | 89 | RPL43A Ribosomal protein L37AE/L43A [Translation, | 94.34 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 94.29 | |
| KOG2793 | 248 | consensus Putative N2,N2-dimethylguanosine tRNA me | 94.25 | |
| PF04606 | 47 | Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: I | 94.2 | |
| PF11781 | 36 | RRN7: RNA polymerase I-specific transcription init | 94.15 | |
| COG5459 | 484 | Predicted rRNA methylase [Translation, ribosomal s | 94.03 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 93.95 | |
| PF01096 | 39 | TFIIS_C: Transcription factor S-II (TFIIS); InterP | 93.91 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 93.9 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 93.86 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 93.75 | |
| KOG1088 | 124 | consensus Uncharacterized conserved protein [Funct | 93.72 | |
| COG1867 | 380 | TRM1 N2,N2-dimethylguanosine tRNA methyltransferas | 93.67 | |
| PRK10220 | 111 | hypothetical protein; Provisional | 93.64 | |
| TIGR00686 | 109 | phnA alkylphosphonate utilization operon protein P | 93.62 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 93.46 | |
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 93.43 | |
| cd08283 | 386 | FDH_like_1 Glutathione-dependent formaldehyde dehy | 93.42 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 93.39 | |
| PF11599 | 246 | AviRa: RRNA methyltransferase AviRa; InterPro: IPR | 93.24 | |
| COG3129 | 292 | Predicted SAM-dependent methyltransferase [General | 93.16 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 93.13 | |
| smart00440 | 40 | ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo | 93.02 | |
| KOG1099 | 294 | consensus SAM-dependent methyltransferase/cell div | 93.0 | |
| COG1656 | 165 | Uncharacterized conserved protein [Function unknow | 92.98 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 92.86 | |
| KOG2671 | 421 | consensus Putative RNA methylase [Replication, rec | 92.81 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 92.58 | |
| KOG0822 | 649 | consensus Protein kinase inhibitor [Cell cycle con | 92.45 | |
| PF03119 | 28 | DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f | 92.39 | |
| PF01861 | 243 | DUF43: Protein of unknown function DUF43; InterPro | 92.24 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 92.22 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 92.2 | |
| KOG2198 | 375 | consensus tRNA cytosine-5-methylases and related e | 92.16 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 92.15 | |
| COG4306 | 160 | Uncharacterized protein conserved in bacteria [Fun | 92.15 | |
| PF01780 | 90 | Ribosomal_L37ae: Ribosomal L37ae protein family; I | 92.12 | |
| KOG2691 | 113 | consensus RNA polymerase II subunit 9 [Transcripti | 92.12 | |
| PF14353 | 128 | CpXC: CpXC protein | 92.1 | |
| PF04072 | 183 | LCM: Leucine carboxyl methyltransferase; InterPro: | 91.9 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 91.84 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 91.64 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 91.56 | |
| COG3510 | 237 | CmcI Cephalosporin hydroxylase [Defense mechanisms | 91.49 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 91.33 | |
| PF01927 | 147 | Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 T | 90.95 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 90.86 | |
| KOG1596 | 317 | consensus Fibrillarin and related nucleolar RNA-bi | 90.72 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 90.57 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 90.47 | |
| KOG1122 | 460 | consensus tRNA and rRNA cytosine-C5-methylase (nuc | 90.43 | |
| PTZ00357 | 1072 | methyltransferase; Provisional | 90.39 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 90.22 | |
| COG1255 | 129 | Uncharacterized protein conserved in archaea [Func | 90.19 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 90.18 | |
| COG1779 | 201 | C4-type Zn-finger protein [General function predic | 90.07 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 89.4 | |
| COG3809 | 88 | Uncharacterized protein conserved in bacteria [Fun | 89.26 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 89.15 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 89.08 | |
| PTZ00255 | 90 | 60S ribosomal protein L37a; Provisional | 89.07 | |
| PF14205 | 55 | Cys_rich_KTR: Cysteine-rich KTR | 89.02 | |
| COG1571 | 421 | Predicted DNA-binding protein containing a Zn-ribb | 89.01 | |
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 88.95 | |
| PF02150 | 35 | RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I | 88.87 | |
| KOG2651 | 476 | consensus rRNA adenine N-6-methyltransferase [RNA | 88.59 | |
| TIGR03655 | 53 | anti_R_Lar restriction alleviation protein, Lar fa | 88.52 | |
| KOG1562 | 337 | consensus Spermidine synthase [Amino acid transpor | 88.47 | |
| PF03514 | 374 | GRAS: GRAS domain family; InterPro: IPR005202 Sequ | 88.35 | |
| COG1594 | 113 | RPB9 DNA-directed RNA polymerase, subunit M/Transc | 88.28 | |
| PF05206 | 259 | TRM13: Methyltransferase TRM13; InterPro: IPR00787 | 88.04 | |
| KOG2906 | 105 | consensus RNA polymerase III subunit C11 [Transcri | 88.03 | |
| PF14354 | 61 | Lar_restr_allev: Restriction alleviation protein L | 87.62 | |
| TIGR00280 | 91 | L37a ribosomal protein L37a. This model finds euka | 87.6 | |
| KOG2539 | 491 | consensus Mitochondrial/chloroplast ribosome small | 87.55 | |
| PF11899 | 380 | DUF3419: Protein of unknown function (DUF3419); In | 87.48 | |
| COG3677 | 129 | Transposase and inactivated derivatives [DNA repli | 87.46 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 87.34 | |
| COG0777 | 294 | AccD Acetyl-CoA carboxylase beta subunit [Lipid me | 87.15 | |
| PRK03976 | 90 | rpl37ae 50S ribosomal protein L37Ae; Reviewed | 87.14 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 87.0 | |
| COG3877 | 122 | Uncharacterized protein conserved in bacteria [Fun | 86.9 | |
| COG4888 | 104 | Uncharacterized Zn ribbon-containing protein [Gene | 86.89 | |
| TIGR00244 | 147 | transcriptional regulator NrdR. Members of this al | 86.82 | |
| PF03492 | 334 | Methyltransf_7: SAM dependent carboxyl methyltrans | 86.81 | |
| COG1568 | 354 | Predicted methyltransferases [General function pre | 86.8 | |
| PLN02668 | 386 | indole-3-acetate carboxyl methyltransferase | 86.8 | |
| PHA02998 | 195 | RNA polymerase subunit; Provisional | 86.72 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 86.37 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 86.25 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 86.1 | |
| COG1327 | 156 | Predicted transcriptional regulator, consists of a | 85.93 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 85.73 | |
| PRK14892 | 99 | putative transcription elongation factor Elf1; Pro | 85.67 | |
| COG4301 | 321 | Uncharacterized conserved protein [Function unknow | 85.6 | |
| cd08254 | 338 | hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo | 85.59 | |
| TIGR00027 | 260 | mthyl_TIGR00027 methyltransferase, putative, TIGR0 | 85.58 | |
| PF05129 | 81 | Elf1: Transcription elongation factor Elf1 like; I | 85.46 | |
| PF12760 | 46 | Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int | 85.42 | |
| KOG2907 | 116 | consensus RNA polymerase I transcription factor TF | 85.11 | |
| PRK05978 | 148 | hypothetical protein; Provisional | 84.86 | |
| COG1326 | 201 | Uncharacterized archaeal Zn-finger protein [Genera | 84.74 | |
| TIGR01385 | 299 | TFSII transcription elongation factor S-II. This m | 84.54 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 84.34 | |
| COG5349 | 126 | Uncharacterized protein conserved in bacteria [Fun | 84.27 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 84.24 | |
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 84.17 | |
| KOG3507 | 62 | consensus DNA-directed RNA polymerase, subunit RPB | 84.11 | |
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 84.02 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 83.85 | |
| PRK12495 | 226 | hypothetical protein; Provisional | 83.84 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 83.43 | |
| PF13453 | 41 | zf-TFIIB: Transcription factor zinc-finger | 83.22 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 82.94 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 82.84 | |
| COG0863 | 302 | DNA modification methylase [DNA replication, recom | 82.8 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 82.28 | |
| PF09855 | 64 | DUF2082: Nucleic-acid-binding protein containing Z | 82.18 | |
| PF10083 | 158 | DUF2321: Uncharacterized protein conserved in bact | 81.77 | |
| PF05050 | 167 | Methyltransf_21: Methyltransferase FkbM domain; In | 81.61 | |
| PF08996 | 188 | zf-DNA_Pol: DNA Polymerase alpha zinc finger; Inte | 81.6 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 81.48 | |
| TIGR03831 | 46 | YgiT_finger YgiT-type zinc finger domain. This dom | 81.39 | |
| COG2824 | 112 | PhnA Uncharacterized Zn-ribbon-containing protein | 81.33 | |
| KOG2782 | 303 | consensus Putative SAM dependent methyltransferase | 80.8 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 80.53 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 80.51 | |
| PRK12380 | 113 | hydrogenase nickel incorporation protein HybF; Pro | 80.4 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 80.15 |
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
Probab=99.92 E-value=1.4e-24 Score=189.79 Aligned_cols=149 Identities=26% Similarity=0.321 Sum_probs=127.6
Q ss_pred eeeeccccCccCcCCCchhhhhhhcCchhhHHhHHhHHHhhhhCCCCCcHHHHHHHHHHhhccCCCeEEEEcCCcChHHH
Q 020988 103 YLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERGWRQNFNRSGFPGPDEEFKMAQEYFKSAQGGLLVDVSCGSGLFSR 182 (319)
Q Consensus 103 ~~~~~~~~~~~~y~~~~~~~~~~~~~~~~s~~~~~~w~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~VLDiGcG~G~~~~ 182 (319)
.+.-++++.++.||.. |+++|++.++.|++.+. ..+...+|.+|||||||||.++.
T Consensus 12 ~v~~vF~~ia~~YD~~---------n~~~S~g~~~~Wr~~~i---------------~~~~~~~g~~vLDva~GTGd~a~ 67 (238)
T COG2226 12 KVQKVFDKVAKKYDLM---------NDLMSFGLHRLWRRALI---------------SLLGIKPGDKVLDVACGTGDMAL 67 (238)
T ss_pred HHHHHHHhhHHHHHhh---------cccccCcchHHHHHHHH---------------HhhCCCCCCEEEEecCCccHHHH
Confidence 3444555666677743 78899999999997543 34444489999999999999999
Q ss_pred HHHhhCCCCeEEEEeCCHHHHHHHHHHHhhcCccCCCCeEEEEcCCCCCCCCCCCccEEEecccccCCCCHHHHHHHHHH
Q 020988 183 KFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAASVFSS 262 (319)
Q Consensus 183 ~l~~~g~~~~v~gvD~s~~~l~~a~~~~~~~~~~~~~~i~~~~~d~~~lp~~~~~fD~V~~~~vl~h~~d~~~~l~el~r 262 (319)
.+++.....+|+|+|+|++|++.|+++....+ ..++.|+.+|+++|||++++||+|++.++|++++|++.+|+|+.|
T Consensus 68 ~~~k~~g~g~v~~~D~s~~ML~~a~~k~~~~~---~~~i~fv~~dAe~LPf~D~sFD~vt~~fglrnv~d~~~aL~E~~R 144 (238)
T COG2226 68 LLAKSVGTGEVVGLDISESMLEVAREKLKKKG---VQNVEFVVGDAENLPFPDNSFDAVTISFGLRNVTDIDKALKEMYR 144 (238)
T ss_pred HHHHhcCCceEEEEECCHHHHHHHHHHhhccC---ccceEEEEechhhCCCCCCccCEEEeeehhhcCCCHHHHHHHHHH
Confidence 99999767899999999999999999998753 334999999999999999999999999999999999999999999
Q ss_pred hhcCCCeeEEEEeecc
Q 020988 263 SYSLLSICYLLQFRYT 278 (319)
Q Consensus 263 vlk~g~~~g~~~~~~~ 278 (319)
||||||...++-|...
T Consensus 145 VlKpgG~~~vle~~~p 160 (238)
T COG2226 145 VLKPGGRLLVLEFSKP 160 (238)
T ss_pred hhcCCeEEEEEEcCCC
Confidence 9999999998888443
|
|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >KOG1331 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PRK11827 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG2835 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >KOG3115 consensus Methyltransferase-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4058 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3201 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A | Back alignment and domain information |
|---|
| >PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >PRK09678 DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] | Back alignment and domain information |
|---|
| >COG4798 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >COG4627 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C | Back alignment and domain information |
|---|
| >KOG1501 consensus Arginine N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >PHA01634 hypothetical protein | Back alignment and domain information |
|---|
| >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases | Back alignment and domain information |
|---|
| >PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] | Back alignment and domain information |
|---|
| >COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF04606 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr | Back alignment and domain information |
|---|
| >PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] | Back alignment and domain information |
|---|
| >COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >KOG1088 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10220 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00686 phnA alkylphosphonate utilization operon protein PhnA | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes | Back alignment and domain information |
|---|
| >COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >smart00440 ZnF_C2C2 C2C2 Zinc finger | Back alignment and domain information |
|---|
| >KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >COG1656 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >COG4306 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG2691 consensus RNA polymerase II subunit 9 [Transcription] | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF04072 LCM: Leucine carboxyl methyltransferase; InterPro: IPR007213 This entry represents a group of leucine carboxymethyltransferases which methylate the carboxyl group of leucine residues to form alpha-leucine ester residues | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PF01927 Mut7-C: Mut7-C RNAse domain; InterPro: IPR002782 This prokaryotic family of proteins have no known function | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00357 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >COG1255 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >COG1779 C4-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >COG3809 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >PTZ00255 60S ribosomal protein L37a; Provisional | Back alignment and domain information |
|---|
| >PF14205 Cys_rich_KTR: Cysteine-rich KTR | Back alignment and domain information |
|---|
| >COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
| >PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR03655 anti_R_Lar restriction alleviation protein, Lar family | Back alignment and domain information |
|---|
| >KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] | Back alignment and domain information |
|---|
| >COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] | Back alignment and domain information |
|---|
| >PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] | Back alignment and domain information |
|---|
| >KOG2906 consensus RNA polymerase III subunit C11 [Transcription] | Back alignment and domain information |
|---|
| >PF14354 Lar_restr_allev: Restriction alleviation protein Lar | Back alignment and domain information |
|---|
| >TIGR00280 L37a ribosomal protein L37a | Back alignment and domain information |
|---|
| >KOG2539 consensus Mitochondrial/chloroplast ribosome small subunit component [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF11899 DUF3419: Protein of unknown function (DUF3419); InterPro: IPR021829 This family of proteins are functionally uncharacterised | Back alignment and domain information |
|---|
| >COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >COG3877 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00244 transcriptional regulator NrdR | Back alignment and domain information |
|---|
| >PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine | Back alignment and domain information |
|---|
| >COG1568 Predicted methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02668 indole-3-acetate carboxyl methyltransferase | Back alignment and domain information |
|---|
| >PHA02998 RNA polymerase subunit; Provisional | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >PRK14892 putative transcription elongation factor Elf1; Provisional | Back alignment and domain information |
|---|
| >COG4301 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family | Back alignment and domain information |
|---|
| >PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines | Back alignment and domain information |
|---|
| >PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc | Back alignment and domain information |
|---|
| >KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12 | Back alignment and domain information |
|---|
| >PRK05978 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01385 TFSII transcription elongation factor S-II | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >COG5349 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7 | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >PRK12495 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PF13453 zf-TFIIB: Transcription factor zinc-finger | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >COG0863 DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins | Back alignment and domain information |
|---|
| >PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 | Back alignment and domain information |
|---|
| >PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function | Back alignment and domain information |
|---|
| >PF08996 zf-DNA_Pol: DNA Polymerase alpha zinc finger; InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR03831 YgiT_finger YgiT-type zinc finger domain | Back alignment and domain information |
|---|
| >COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2782 consensus Putative SAM dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >PRK12380 hydrogenase nickel incorporation protein HybF; Provisional | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 319 | |||
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 4e-15 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 4e-15 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 6e-15 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 3e-14 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 4e-14 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 1e-13 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 3e-12 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 4e-12 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 4e-12 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 5e-12 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 5e-12 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 5e-12 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 6e-12 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 1e-11 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 1e-11 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 1e-11 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 2e-11 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 3e-11 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 4e-11 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 4e-11 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 6e-11 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 9e-11 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 1e-10 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 1e-10 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 2e-10 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 4e-10 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 8e-10 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 2e-09 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 2e-09 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 2e-09 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 2e-09 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 2e-09 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 2e-09 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 3e-09 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 3e-09 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 5e-08 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 6e-08 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 7e-08 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 1e-07 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 1e-07 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 2e-07 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 3e-07 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 4e-07 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 6e-07 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 6e-07 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 9e-07 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 1e-06 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 1e-06 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 1e-06 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 1e-06 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 4e-06 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 8e-06 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 2e-05 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 2e-05 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 4e-05 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 2e-04 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 4e-04 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 7e-04 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 8e-04 |
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 | Back alignment and structure |
|---|
Score = 72.1 bits (177), Expect = 4e-15
Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 3/91 (3%)
Query: 166 QGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVR 225
G +D+ G G S AK +S + ALDFS++M I N L + +V+
Sbjct: 43 TAGTCIDIGSGPGALSIALAKQSDFS-IRALDFSKHMNEIALKNIADAN--LNDRIQIVQ 99
Query: 226 ADVCRLPFASGFVDAVHAGAALHCWPSPSNA 256
DV +P + D + + ++ W + A
Sbjct: 100 GDVHNIPIEDNYADLIVSRGSVFFWEDVATA 130
|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Length = 299 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Length = 286 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Length = 230 | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Length = 225 | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 319 | |||
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 99.82 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 99.81 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 99.78 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.77 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.74 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 99.74 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 99.74 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 99.74 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 99.73 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 99.73 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 99.72 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 99.72 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 99.72 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 99.72 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 99.71 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 99.71 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 99.71 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 99.71 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 99.7 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 99.7 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 99.7 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 99.7 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 99.7 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 99.7 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.7 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 99.69 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 99.69 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 99.69 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 99.69 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 99.69 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 99.69 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 99.68 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 99.68 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 99.68 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 99.67 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 99.67 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 99.66 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 99.66 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 99.66 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 99.66 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 99.66 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 99.66 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 99.66 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 99.65 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 99.65 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 99.65 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 99.64 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.64 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 99.64 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 99.63 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 99.63 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 99.63 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.62 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 99.62 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 99.62 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 99.62 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 99.62 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 99.62 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 99.62 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 99.62 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 99.6 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 99.6 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 99.59 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 99.59 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 99.59 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 99.59 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 99.58 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 99.58 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 99.58 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 99.57 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 99.57 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 99.56 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 99.56 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 99.56 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 99.56 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 99.55 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 99.55 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 99.55 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 99.55 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 99.55 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 99.54 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 99.54 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 99.54 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 99.54 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 99.53 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 99.53 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 99.53 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 99.53 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 99.52 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 99.52 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 99.52 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 99.51 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 99.51 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.51 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 99.51 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 99.5 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.5 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 99.5 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.5 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 99.5 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 99.5 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 99.49 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.49 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 99.49 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.49 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.49 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 99.49 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 99.49 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.49 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 99.49 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 99.49 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 99.49 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 99.49 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 99.49 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 99.48 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.48 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 99.48 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 99.48 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 99.48 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 99.48 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 99.48 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 99.47 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 99.47 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 99.47 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 99.46 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 99.46 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 99.46 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.46 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 99.46 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.46 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 99.45 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 99.44 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 99.44 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 99.44 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 99.44 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 99.43 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 99.43 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 99.43 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 99.43 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 99.43 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 99.43 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 99.43 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 99.43 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 99.42 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 99.42 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 99.42 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 99.41 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 99.41 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 99.41 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 99.41 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 99.4 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 99.4 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 99.4 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 99.4 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 99.39 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 99.39 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 99.39 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 99.39 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.39 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 99.38 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 99.38 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 99.38 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 99.37 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 99.37 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 99.37 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.37 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 99.37 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 99.37 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 99.36 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 99.36 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 99.36 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 99.35 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 99.35 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 99.35 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 99.35 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 99.34 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 99.34 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 99.34 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 99.34 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 99.33 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 99.33 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 99.32 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 99.32 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 99.31 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 99.31 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 99.31 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 99.3 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 99.3 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 99.3 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 99.29 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.29 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 99.29 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 99.29 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 99.29 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 99.28 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 99.28 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 99.27 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 99.27 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 99.26 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 99.26 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 99.25 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 99.25 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 99.25 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 99.24 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 99.24 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 99.24 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 99.24 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 99.24 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 99.23 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 99.23 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 99.23 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 99.22 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 99.21 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 99.2 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 99.19 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 99.19 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 99.19 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 99.18 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 99.18 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 99.18 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 99.17 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 99.17 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 99.17 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 99.15 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 99.15 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 99.15 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 99.14 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 99.14 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 99.13 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 99.13 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 99.13 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 99.12 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 99.11 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 99.1 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 99.1 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 99.09 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 99.08 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 99.07 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 99.06 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 99.06 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 99.05 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 99.05 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 99.04 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 99.04 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 99.04 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 98.99 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.98 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 98.98 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 98.98 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 98.97 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 98.96 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 98.96 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 98.95 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 98.95 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 98.94 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 98.94 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 98.93 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 98.92 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 98.87 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 98.86 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 98.86 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 98.81 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 98.8 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 98.79 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 98.77 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 98.75 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 98.73 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 98.69 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 98.65 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 98.63 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 98.61 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.58 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 98.58 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 98.56 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 98.51 | |
| 2jny_A | 67 | Uncharacterized BCR; structure, CGR1, NESG, struct | 98.35 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 98.35 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 98.33 | |
| 2jr6_A | 68 | UPF0434 protein NMA0874; solution, structural geno | 98.33 | |
| 2hf1_A | 68 | Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A | 98.32 | |
| 2js4_A | 70 | UPF0434 protein BB2007; NESG, northeast structural | 98.31 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 98.31 | |
| 2pk7_A | 69 | Uncharacterized protein; NESG, PLR1, putative tetr | 98.3 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 98.24 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 98.24 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 98.23 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 98.21 | |
| 2kpi_A | 56 | Uncharacterized protein SCO3027; zinc finger, PSI- | 98.17 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 98.13 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 98.1 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 98.09 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 98.01 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 98.01 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 98.0 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 97.96 | |
| 2k5r_A | 97 | Uncharacterized protein XF2673; solution structure | 97.96 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 97.82 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 97.8 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 97.71 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 97.68 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 97.68 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 97.65 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 97.47 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 97.39 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 97.36 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 97.33 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 97.3 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 96.92 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 96.74 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 96.52 | |
| 3r24_A | 344 | NSP16, 2'-O-methyl transferase; methyltransferase, | 96.45 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 96.09 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 95.94 | |
| 2k5c_A | 95 | Uncharacterized protein PF0385; structural genomic | 95.66 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 95.5 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 95.4 | |
| 3q87_A | 125 | Putative uncharacterized protein ECU08_1170; SAM-m | 95.36 | |
| 1eg2_A | 319 | Modification methylase RSRI; rossmann fold, exocyc | 95.2 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 95.07 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 95.0 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 94.6 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 94.57 | |
| 1qyp_A | 57 | RNA polymerase II; transcription, RPB9, Zn ribbon, | 94.46 | |
| 2akl_A | 138 | PHNA-like protein PA0128; two domains, Zn binding | 94.12 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 94.08 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 93.85 | |
| 1zkd_A | 387 | DUF185; NESG, RPR58, structural genomics, PSI, pro | 93.83 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 93.54 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 93.31 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 93.26 | |
| 2qrv_A | 295 | DNA (cytosine-5)-methyltransferase 3A; DNA methylt | 92.92 | |
| 4f3n_A | 432 | Uncharacterized ACR, COG1565 superfamily; structur | 92.69 | |
| 4h0n_A | 333 | DNMT2; SAH binding, transferase; HET: SAH; 2.71A { | 92.64 | |
| 2j6a_A | 141 | Protein TRM112; translation termination, methyltra | 92.55 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 92.22 | |
| 1tfi_A | 50 | Transcriptional elongation factor SII; transcripti | 92.03 | |
| 3jyw_9 | 72 | 60S ribosomal protein L43; eukaryotic ribosome, RA | 91.74 | |
| 3cc2_Z | 116 | 50S ribosomal protein L37AE, 50S ribosomal protein | 91.64 | |
| 3j21_i | 83 | 50S ribosomal protein L37AE; archaea, archaeal, KI | 91.62 | |
| 2k4x_A | 55 | 30S ribosomal protein S27AE; metal-binding, ribonu | 91.37 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 91.23 | |
| 3iz5_m | 92 | 60S ribosomal protein L43 (L37AE); eukaryotic ribo | 90.95 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 90.78 | |
| 3tos_A | 257 | CALS11; methyltransferase, calicheamicin, structur | 90.78 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 90.77 | |
| 1ffk_W | 73 | Ribosomal protein L37AE; ribosome assembly, RNA-RN | 90.57 | |
| 4a17_Y | 103 | RPL37A, 60S ribosomal protein L32; eukaryotic ribo | 90.42 | |
| 3izc_m | 92 | 60S ribosomal protein RPL43 (L37AE); eukaryotic ri | 90.22 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 90.16 | |
| 3h0g_L | 63 | DNA-directed RNA polymerases I, II, and III subuni | 89.96 | |
| 3po3_S | 178 | Transcription elongation factor S-II; RNA polymera | 89.69 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 89.56 | |
| 3me5_A | 482 | Cytosine-specific methyltransferase; structural ge | 88.66 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 88.42 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 87.99 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 87.56 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 87.49 | |
| 1wii_A | 85 | Hypothetical UPF0222 protein MGC4549; domain of un | 87.37 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 86.9 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 86.75 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 86.15 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 86.05 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 86.03 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 86.02 | |
| 3vyw_A | 308 | MNMC2; tRNA wobble uridine, modification enzyme, g | 86.01 | |
| 1twf_I | 122 | B12.6, DNA-directed RNA polymerase II 14.2 kDa pol | 85.9 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 85.77 | |
| 1pqv_S | 309 | STP-alpha, transcription elongation factor S-II, D | 85.28 | |
| 3ga8_A | 78 | HTH-type transcriptional regulator MQSA (YGIT/B30; | 85.1 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 84.73 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 84.62 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 84.51 | |
| 3j21_g | 51 | 50S ribosomal protein L40E; archaea, archaeal, KIN | 83.9 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 83.3 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 83.03 | |
| 3iht_A | 174 | S-adenosyl-L-methionine methyl transferase; YP_165 | 82.94 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 82.51 | |
| 3flo_B | 206 | DNA polymerase alpha catalytic subunit A; protein- | 82.49 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 81.89 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 81.86 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 81.41 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 80.27 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 80.18 |
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
Probab=99.82 E-value=1.3e-20 Score=178.99 Aligned_cols=112 Identities=10% Similarity=0.109 Sum_probs=87.2
Q ss_pred HHHHHHhhccCCCeEEEEcCCcChHHHHHHhhCCCCeEEEEeCCHHHHHHHHHHHhhcCccCCCCeEEEEcCCCCCCCCC
Q 020988 156 KMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFAS 235 (319)
Q Consensus 156 ~~l~~~l~~~~~~~VLDiGcG~G~~~~~l~~~g~~~~v~gvD~s~~~l~~a~~~~~~~~~~~~~~i~~~~~d~~~lp~~~ 235 (319)
+.+.+.+...++.+|||||||+|.++..+++.+. +|+|+|+|+.+++.|+++-.. .....+...+...+++.+
T Consensus 97 ~~l~~~~~~~~~~~VLDiGcG~G~~~~~l~~~g~--~v~gvD~s~~~~~~a~~~~~~-----~~~~~~~~~~~~~l~~~~ 169 (416)
T 4e2x_A 97 RDFLATELTGPDPFIVEIGCNDGIMLRTIQEAGV--RHLGFEPSSGVAAKAREKGIR-----VRTDFFEKATADDVRRTE 169 (416)
T ss_dssp HHHHHTTTCSSSCEEEEETCTTTTTHHHHHHTTC--EEEEECCCHHHHHHHHTTTCC-----EECSCCSHHHHHHHHHHH
T ss_pred HHHHHHhCCCCCCEEEEecCCCCHHHHHHHHcCC--cEEEECCCHHHHHHHHHcCCC-----cceeeechhhHhhcccCC
Confidence 4555556666789999999999999999999876 999999999999999875110 001112233444566667
Q ss_pred CCccEEEecccccCCCCHHHHHHHHHHhhcCCCeeEEEE
Q 020988 236 GFVDAVHAGAALHCWPSPSNAASVFSSSYSLLSICYLLQ 274 (319)
Q Consensus 236 ~~fD~V~~~~vl~h~~d~~~~l~el~rvlk~g~~~g~~~ 274 (319)
++||+|++.++++|++|+..++++++++|||+|.+.+..
T Consensus 170 ~~fD~I~~~~vl~h~~d~~~~l~~~~r~LkpgG~l~i~~ 208 (416)
T 4e2x_A 170 GPANVIYAANTLCHIPYVQSVLEGVDALLAPDGVFVFED 208 (416)
T ss_dssp CCEEEEEEESCGGGCTTHHHHHHHHHHHEEEEEEEEEEE
T ss_pred CCEEEEEECChHHhcCCHHHHHHHHHHHcCCCeEEEEEe
Confidence 899999999999999999999999999999876555433
|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >3q87_A Putative uncharacterized protein ECU08_1170; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* | Back alignment and structure |
|---|
| >4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} | Back alignment and structure |
|---|
| >2j6a_A Protein TRM112; translation termination, methyltransferase, transferase, ERF1, nuclear protein, protein methylation; 1.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} | Back alignment and structure |
|---|
| >3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z | Back alignment and structure |
|---|
| >3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* | Back alignment and structure |
|---|
| >4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3po3_S Transcription elongation factor S-II; RNA polymerase II, mRNA, transcription, arrest, BACKTRACKING cleavage, transferase-DNA-RNA complex; HET: DNA BRU EPE PGE; 3.30A {Saccharomyces cerevisiae} PDB: 1y1v_S 1y1y_S 3gtm_S* 1enw_A | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* | Back alignment and structure |
|---|
| >1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1pqv_S STP-alpha, transcription elongation factor S-II, DNA; mRNA cleavage, proofreading, BACKTRACKING, gene expression, multiprotein complex; 3.80A {Saccharomyces cerevisiae} SCOP: i.8.1.1 PDB: 1eo0_A | Back alignment and structure |
|---|
| >3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >3flo_B DNA polymerase alpha catalytic subunit A; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 319 | ||||
| d1p91a_ | 268 | c.66.1.33 (A:) rRNA methyltransferase RlmA {Escher | 5e-13 | |
| d1l3ia_ | 186 | c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi | 1e-07 | |
| d1nw3a_ | 328 | c.66.1.31 (A:) Catalytic, N-terminal domain of his | 5e-06 | |
| d1ri5a_ | 252 | c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf | 6e-05 | |
| d2fyta1 | 311 | c.66.1.6 (A:238-548) Protein arginine N-methyltran | 8e-05 | |
| d1oria_ | 316 | c.66.1.6 (A:) Protein arginine N-methyltransferase | 1e-04 | |
| d1vl5a_ | 231 | c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill | 0.001 | |
| d1jqea_ | 280 | c.66.1.19 (A:) Histamine methyltransferase {Human | 0.001 | |
| d1nt2a_ | 209 | c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch | 0.001 | |
| d2g72a1 | 263 | c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr | 0.003 | |
| d1xxla_ | 234 | c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus | 0.003 | |
| d1xvaa_ | 292 | c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra | 0.003 | |
| d1g8sa_ | 230 | c.66.1.3 (A:) Fibrillarin homologue {Archaeon Meth | 0.004 |
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Length = 268 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: rRNA methyltransferase RlmA domain: rRNA methyltransferase RlmA species: Escherichia coli [TaxId: 562]
Score = 65.7 bits (159), Expect = 5e-13
Identities = 37/189 (19%), Positives = 72/189 (38%), Gaps = 33/189 (17%)
Query: 61 FSCPICYEPLIRKGPTGLTLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKP 120
FSCP+C++PL R+ + + C + + +K+ Y++L + +
Sbjct: 2 FSCPLCHQPLSREKNS-----------YICPQRHQFDMAKEGYVNLLPVQHKRSRDPGD- 49
Query: 121 ASTELFRSPFVSFLYERGWRQNFNRSGFPGPDEEFKMAQ-EYFKSAQGGLLVDVSCGSGL 179
S E+ ++ R+ F +G P + +AQ + ++D+ CG G
Sbjct: 50 -SAEMMQA-----------RRAFLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGY 97
Query: 180 FSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTILTSNLALVRADVCRLPFASGFVD 239
++ FA + LD S+ ++ Q + RLPF+ +D
Sbjct: 98 YTHAFADALPEITTFGLDVSKVAIKAAAKRYPQVTFCVA--------SSHRLPFSDTSMD 149
Query: 240 AVHAGAALH 248
A+ A
Sbjct: 150 AIIRIYAPC 158
|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 280 | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 319 | |||
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 99.94 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.87 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.87 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.83 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.81 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 99.8 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 99.76 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 99.76 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 99.75 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.75 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.74 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 99.74 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 99.73 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 99.7 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 99.7 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 99.69 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 99.67 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 99.67 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 99.67 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 99.66 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 99.66 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.66 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.65 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 99.64 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 99.62 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 99.6 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.59 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 99.57 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 99.57 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 99.57 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 99.56 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 99.56 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 99.55 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 99.54 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.51 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 99.49 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 99.47 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 99.47 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 99.47 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 99.47 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 99.46 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 99.45 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 99.43 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 99.43 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 99.37 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 99.36 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 99.33 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 99.3 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 99.28 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 99.21 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 99.15 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 99.15 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 99.14 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 99.13 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 99.09 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 99.07 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 98.99 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 98.96 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 98.95 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 98.94 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 98.94 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 98.85 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 98.85 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 98.85 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 98.82 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 98.76 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 98.76 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 98.76 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 98.7 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 98.7 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 98.67 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 98.64 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 98.64 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 98.62 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 98.49 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 98.46 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 98.41 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 98.36 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 98.36 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 98.35 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 98.35 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 98.33 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 98.31 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 98.25 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 98.22 | |
| d2jnya1 | 59 | Uncharacterized protein Cgl1405/cg1592 {Corynebact | 98.19 | |
| d2pk7a1 | 59 | Uncharacterized protein PFL1779 {Pseudomonas fluor | 98.13 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 98.13 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 98.13 | |
| d2hf1a1 | 59 | Hypothetical protein CV3345 {Chromobacterium viola | 98.1 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 98.08 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 98.04 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 98.02 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 98.01 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 98.0 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 97.96 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 97.82 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 97.81 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 97.78 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 97.65 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 97.56 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 97.31 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 97.14 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 96.94 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 96.55 | |
| d2akla2 | 38 | Hypothetical protein PA0128, N-terminal domain {Ps | 96.4 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 96.26 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 95.82 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 95.76 | |
| d1tfia_ | 50 | Transcriptional factor SII, C-terminal domain {Hum | 95.22 | |
| d1twfi2 | 72 | RBP9 subunit of RNA polymerase II {Baker's yeast ( | 95.19 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 95.08 | |
| d1qypa_ | 57 | RBP9 subunit of RNA polymerase II {Archaeon Thermo | 95.08 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 95.08 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 94.46 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 94.25 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 94.15 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 94.05 | |
| d1pfva3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch | 93.25 | |
| d1rqga3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro | 93.01 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 92.91 | |
| d1vqoz1 | 73 | Ribosomal protein L37ae {Archaeon Haloarcula maris | 92.82 | |
| d1jj2y_ | 73 | Ribosomal protein L37ae {Archaeon Haloarcula maris | 92.8 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 92.55 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 92.21 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 91.69 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 91.69 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 91.67 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 91.61 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 91.42 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 91.37 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 90.35 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 89.99 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 89.96 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 89.94 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 89.61 | |
| d1rjda_ | 328 | Leucine carboxy methyltransferase Ppm1 {Baker's ye | 89.54 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 88.94 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 88.69 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 88.68 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 88.38 | |
| d2uyoa1 | 297 | Putative methyltransferase ML2640 {Mycobacterium l | 88.31 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 87.97 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 87.86 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 87.85 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 86.5 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 86.06 | |
| d2f9yb1 | 263 | Acetyl-coenzyme A carboxylase carboxyl transferase | 85.74 | |
| d1o9ga_ | 249 | rRNA methyltransferase AviRa {Streptomyces viridoc | 85.43 | |
| d2py6a1 | 395 | Methyltransferase FkbM {Methylobacillus flagellatu | 85.02 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 84.45 | |
| d1twfl_ | 46 | RBP12 subunit of RNA polymerase II {Baker's yeast | 84.42 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 84.19 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 84.08 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 83.95 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 83.66 | |
| d1m6ex_ | 359 | Salicylic acid carboxyl methyltransferase (SAMT) { | 83.19 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 82.85 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 82.76 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 82.66 | |
| d1wiia_ | 85 | Hypothetical UPF0222 protein MGC4549 {Mouse (Mus m | 82.32 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 81.91 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 80.66 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 80.23 |
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: rRNA methyltransferase RlmA domain: rRNA methyltransferase RlmA species: Escherichia coli [TaxId: 562]
Probab=99.94 E-value=8.5e-26 Score=200.67 Aligned_cols=178 Identities=21% Similarity=0.357 Sum_probs=130.9
Q ss_pred eeccCCCccccccCCCCCcccceecCceeeCccCCcc-ccCCceeeeccccCccCcCCCchhhhhhhcCchhhHHhHHhH
Q 020988 61 FSCPICYEPLIRKGPTGLTLGAIYRSGFKCRKCDKTY-SSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERGW 139 (319)
Q Consensus 61 l~CP~C~~~l~~~~~~~~~~~~i~~~~~~C~~Cg~~f-~~~~g~~~~~~~~~~~~y~~~~~~~~~~~~~~~~s~~~~~~w 139 (319)
|+||+|+++|...+ +.+.|.+|. .| ..++||+++++.+....|+... .++++..
T Consensus 2 f~CP~C~~~L~~~~-----------~~l~C~~~h-~fd~~~~Gy~~ll~~~~~~~~~~~~--~~~~~~a----------- 56 (268)
T d1p91a_ 2 FSCPLCHQPLSREK-----------NSYICPQRH-QFDMAKEGYVNLLPVQHKRSRDPGD--SAEMMQA----------- 56 (268)
T ss_dssp BBCTTTCCBCEEET-----------TEEECTTCC-EEEBCTTSCEECSCSSSSCSCCCSS--SHHHHHH-----------
T ss_pred ccCCCCChhhhcCC-----------CeEECCCCC-ccccccCceEecccccccccCCCCC--CHHHHHH-----------
Confidence 79999999987654 568999965 56 6678999998766554433211 1223221
Q ss_pred HHhhhhCCCCCcHHH--HHHHHHHhhccCCCeEEEEcCCcChHHHHHHhhCCCCeEEEEeCCHHHHHHHHHHHhhcCccC
Q 020988 140 RQNFNRSGFPGPDEE--FKMAQEYFKSAQGGLLVDVSCGSGLFSRKFAKSGTYSGVVALDFSENMLRQCYDFIKQDNTIL 217 (319)
Q Consensus 140 ~~~~~~~~~~~~~~~--~~~l~~~l~~~~~~~VLDiGcG~G~~~~~l~~~g~~~~v~gvD~s~~~l~~a~~~~~~~~~~~ 217 (319)
++.+...+++.+... ...+...+ ..++.+|||||||+|.++..+++.++..+++|+|+|+.|++.|+++.
T Consensus 57 r~~~l~~g~~~~l~~~~~~~l~~~~-~~~~~~iLDiGcG~G~~~~~l~~~~~~~~~~giD~s~~~~~~a~~~~------- 128 (268)
T d1p91a_ 57 RRAFLDAGHYQPLRDAIVAQLRERL-DDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRY------- 128 (268)
T ss_dssp HHHHHTTTTTHHHHHHHHHHHHHHS-CTTCCEEEEETCTTSTTHHHHHHTCTTSEEEEEESCHHHHHHHHHHC-------
T ss_pred HHHHHHcCchHHHHHHHHHHHHHhc-CCCCCEEEEeCCCCcHHHHHHHHHCCCCEEEEecchHhhhhhhhccc-------
Confidence 233333343322111 22333333 35678999999999999999999988889999999999999998863
Q ss_pred CCCeEEEEcCCCCCCCCCCCccEEEecccccCCCCHHHHHHHHHHhhcCCCeeEEEEeeccc
Q 020988 218 TSNLALVRADVCRLPFASGFVDAVHAGAALHCWPSPSNAASVFSSSYSLLSICYLLQFRYTK 279 (319)
Q Consensus 218 ~~~i~~~~~d~~~lp~~~~~fD~V~~~~vl~h~~d~~~~l~el~rvlk~g~~~g~~~~~~~~ 279 (319)
+++.++++|+.++|+++++||+|++.++++| ++|+.|+|||+|.+.+..+....
T Consensus 129 -~~~~~~~~d~~~l~~~~~sfD~v~~~~~~~~-------~~e~~rvLkpgG~l~~~~p~~~~ 182 (268)
T d1p91a_ 129 -PQVTFCVASSHRLPFSDTSMDAIIRIYAPCK-------AEELARVVKPGGWVITATPGPRH 182 (268)
T ss_dssp -TTSEEEECCTTSCSBCTTCEEEEEEESCCCC-------HHHHHHHEEEEEEEEEEEECTTT
T ss_pred -ccccceeeehhhccCCCCCEEEEeecCCHHH-------HHHHHHHhCCCcEEEEEeeCCcc
Confidence 5789999999999999999999999998887 47899999988766666554433
|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|