Citrus Sinensis ID: 020997

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIGIVNQQSQIKTHQAAVSSFSSLFQTSSSSSSSSSPSPSPTISYNCNDINAYYTTTARSFTGLERNSSFSNSLLLSSNSCITAQHQVKEKIFMFGGDQASFSSSDGSCSNQQISHGKEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLISSSSSSCNNFLFDENKTEESLVLLNDADCE
ccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHccccHHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccEEEEcccccc
cccccccHccccccccccHHHHHHHHHHHHHccccccHHHccHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccEcccccccEEEEEcccccc
mgrapccdkanvkkgpwspeeDAKLKEYIEkngtggnwialphkaglmrcgksCRLRWLNylrpninhgefsddeDRIICSLFASIGSRWSTIaaqlpgrtdndiknYWNTKLKKKLIGIVNQQSQIKTHQAAVSSFSSlfqtssssssssspspsptisyncndinaYYTTTARsftglernssfsnslllssnsciTAQHQVKEKIFmfggdqasfsssdgscsnqqishgkefdyeyyggrnnkceqmglqnnlfyngvegdnkFMISnvetpldyGLEEIKQLISSSSsscnnflfdenkteESLVLLNDADCE
mgrapccdkanvkkgpwspeedAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNinhgefsddEDRIICSLFASIGSRWstiaaqlpgrtdndikNYWNTKLKKKLIGIVNQQSQIKTHQAAVSSFSSLFQTSsssssssspspspTISYNCNDINAYYTTTARSFTGLERNSSFSNSLLLSSNSCITAQHQVKEKIFMFGGDQASFSSSDGSCSNQQISHGKEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLISSSSSSCNNFLFDEnkteeslvllndadce
MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIGIVNQQSQIKTHQAAVssfsslfqtssssssssspspsptisYNCNDINAYYTTTARSFTGLERnssfsnslllssnsCITAQHQVKEKIFMFGGDQASFSSSDGSCSNQQISHGKEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLIssssssCNNFLFDENKTEESLVLLNDADCE
**************************EYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIGIVNQQ**********************************ISYNCNDINAYYTTTARSFTGLERNSSFSNSLLLSSNSCITAQHQVKEKIFMFG*********************KEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLI*******NNFLF******************
*GRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKK************************************************************************************************************************************CE**G*QNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLISSSSSSCNNFLFDENKTEESLVLLNDAD**
MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIGIVNQQ*********************************TISYNCNDINAYYTTTARSFTGLERNSSFSNSLLLSSNSCITAQHQVKEKIFMFGGDQA*************ISHGKEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLISSSSSSCNNFLFDENKTEESLVLLNDADCE
***APCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIGIV**************************************************************************************************************HGKEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLISSSSSSCNNFLFDENKTEESLVLLNDADC*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIGIVNQQSQIKTHQAAVSSFSSLFQTSSSSSSSSSPSPSPTISYNCNDINAYYTTTARSFTGLERNSSFSNSLLLSSNSCITAQHQVKEKIFMFGGDQASFSSSDGSCSNQQISHGKEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISNVETPLDYGLEEIKQLISSSSSSCNNFLFDENKTEESLVLLNDADCE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
Q9M2Y9310 Transcription factor RAX3 no no 0.371 0.380 0.855 3e-59
Q9FG68329 Transcription factor RAX1 no no 0.490 0.474 0.641 8e-57
Q8GWP0360 Transcription factor MYB3 no no 0.433 0.383 0.564 1e-41
Q7XBH4257 Myb-related protein Myb4 no no 0.364 0.451 0.632 2e-41
P81392316 Myb-related protein 306 O N/A no 0.364 0.367 0.632 2e-41
Q38851236 Transcription repressor M no no 0.424 0.572 0.557 1e-40
P80073 421 Myb-related protein Pp2 O N/A no 0.364 0.275 0.615 3e-40
Q9SZP1282 Transcription repressor M no no 0.512 0.578 0.460 6e-40
P20025255 Myb-related protein Zm38 N/A no 0.455 0.568 0.510 2e-39
Q9S9K9257 Transcription factor MYB3 no no 0.367 0.455 0.584 5e-39
>sp|Q9M2Y9|RAX3_ARATH Transcription factor RAX3 OS=Arabidopsis thaliana GN=RAX3 PE=2 SV=1 Back     alignment and function desciption
 Score =  228 bits (582), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 101/118 (85%), Positives = 108/118 (91%)

Query: 1   MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLN 60
           MGRAPCCDKANVKKGPWSPEEDAKLK YIE +GTGGNWIALP K GL RCGKSCRLRWLN
Sbjct: 1   MGRAPCCDKANVKKGPWSPEEDAKLKSYIENSGTGGNWIALPQKIGLKRCGKSCRLRWLN 60

Query: 61  YLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLI 118
           YLRPNI HG FS++E+ IICSL+ +IGSRWS IAAQLPGRTDNDIKNYWNT+LKKKLI
Sbjct: 61  YLRPNIKHGGFSEEEENIICSLYLTIGSRWSIIAAQLPGRTDNDIKNYWNTRLKKKLI 118
Transcription activator (By similarity). Positively regulates axillary meristems (AMs) formation and development, especially during inflorescence.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9FG68|RAX1_ARATH Transcription factor RAX1 OS=Arabidopsis thaliana GN=RAX1 PE=2 SV=1 Back     alignment and function description
>sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 Back     alignment and function description
>sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 Back     alignment and function description
>sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 Back     alignment and function description
>sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 Back     alignment and function description
>sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 Back     alignment and function description
>sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
224138830331 predicted protein [Populus trichocarpa] 0.921 0.885 0.6 4e-90
225441199342 PREDICTED: transcription factor RAX1 [Vi 0.937 0.871 0.576 2e-84
356533183320 PREDICTED: transcription factor GAMYB-li 0.918 0.912 0.554 1e-79
224118410337 predicted protein [Populus trichocarpa] 0.915 0.863 0.518 1e-77
224069571232 predicted protein [Populus trichocarpa] 0.694 0.952 0.659 8e-76
356548268305 PREDICTED: transcription repressor MYB4- 0.893 0.931 0.544 1e-74
224106830338 predicted protein [Populus trichocarpa] 0.899 0.846 0.498 3e-74
356572470304 PREDICTED: uncharacterized protein LOC77 0.874 0.914 0.514 3e-73
388501912319 unknown [Lotus japonicus] 0.889 0.887 0.527 2e-69
374341580317 ntrax [Nicotiana tabacum] 0.927 0.930 0.489 6e-69
>gi|224138830|ref|XP_002322912.1| predicted protein [Populus trichocarpa] gi|222867542|gb|EEF04673.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  337 bits (864), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 204/340 (60%), Positives = 235/340 (69%), Gaps = 47/340 (13%)

Query: 1   MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLN 60
           MGRAPCCDKANVK+GPWSPEEDAKLKEY+ K+GTGGNWIALP KAGL RCGKSCRLRWLN
Sbjct: 1   MGRAPCCDKANVKRGPWSPEEDAKLKEYMAKHGTGGNWIALPQKAGLKRCGKSCRLRWLN 60

Query: 61  YLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIGI 120
           YLRPNI HGEFSDDEDRIICSL+A+IGSRWS IAAQLPGRTDNDIKNYWNTKLKKKL+G 
Sbjct: 61  YLRPNIKHGEFSDDEDRIICSLYANIGSRWSIIAAQLPGRTDNDIKNYWNTKLKKKLMGS 120

Query: 121 VNQQSQIKTHQAAVSSFSSLFQTSSSSSSSSSPSPSPTISYNCNDINAYYTTTARSFTGL 180
           +N  +  K  QAA   FSSL   +S  SS S+   SP+ S+ C++ N+Y  T ARSFT  
Sbjct: 121 INPDALRKPQQAA--HFSSLLHATSLPSSPST-PLSPSPSFTCSN-NSYNYTLARSFT-- 174

Query: 181 ERNSSFSNSLLLSSNSCITA--------------QHQVKEKIFMFGGDQASFSSSDGSCS 226
               SFS+S  LS+NS  TA               +QVK+ + MFGG+  +  SS     
Sbjct: 175 -EPISFSSS-PLSNNSFTTASMLQPQETFVGSMQNYQVKDNLIMFGGE--ASCSSSDGSC 230

Query: 227 NQQISHGKEFDYEYYGGRNNKCEQMGLQNNLFYNGVEGDNKFMISN-------------- 272
           + Q+SH KE +YE+  G NN   Q+GLQN L +N VE D K M+S+              
Sbjct: 231 SNQMSHVKE-EYEHGDGANNNTGQVGLQNYL-HNRVEDDQKLMVSSGFAGHDVLNGWTGK 288

Query: 273 -----VETPLDYGLEEIKQLISSSSSSCNNFLFDENKTEE 307
                 E PLDYGLEEIKQLI  S+SSCNNFLFDENKT E
Sbjct: 289 QIGLWEENPLDYGLEEIKQLI--STSSCNNFLFDENKTAE 326

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225441199|ref|XP_002270359.1| PREDICTED: transcription factor RAX1 [Vitis vinifera] gi|297739959|emb|CBI30141.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356533183|ref|XP_003535147.1| PREDICTED: transcription factor GAMYB-like [Glycine max] Back     alignment and taxonomy information
>gi|224118410|ref|XP_002331475.1| predicted protein [Populus trichocarpa] gi|222873553|gb|EEF10684.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224069571|ref|XP_002326376.1| predicted protein [Populus trichocarpa] gi|222833569|gb|EEE72046.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356548268|ref|XP_003542525.1| PREDICTED: transcription repressor MYB4-like [Glycine max] Back     alignment and taxonomy information
>gi|224106830|ref|XP_002314299.1| predicted protein [Populus trichocarpa] gi|222850707|gb|EEE88254.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356572470|ref|XP_003554391.1| PREDICTED: uncharacterized protein LOC778084 [Glycine max] Back     alignment and taxonomy information
>gi|388501912|gb|AFK39022.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|374341580|gb|AEZ35207.1| ntrax [Nicotiana tabacum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
TAIR|locus:2057931298 RAX2 "REGULATOR OF AXILLARY ME 0.371 0.395 0.881 6.1e-66
TAIR|locus:2174557333 MYB36 "myb domain protein 36" 0.396 0.378 0.825 2e-56
TAIR|locus:2169970374 MYB68 "myb domain protein 68" 0.396 0.336 0.801 6.8e-56
TAIR|locus:2097335310 MYB84 "myb domain protein 84" 0.396 0.406 0.809 1.1e-55
TAIR|locus:2181146329 MYB37 "myb domain protein 37" 0.393 0.379 0.776 2.4e-53
TAIR|locus:2137589305 MYB87 "myb domain protein 87" 0.371 0.386 0.779 3.1e-51
TAIR|locus:2161820320 MYB80 [Arabidopsis thaliana (t 0.374 0.371 0.658 5.7e-43
TAIR|locus:2088957317 TDF1 "DEFECTIVE IN MERISTEM DE 0.367 0.369 0.644 7.5e-41
TAIR|locus:2098906299 MYB17 "myb domain protein 17" 0.374 0.397 0.625 1.2e-40
TAIR|locus:2150891326 MYB16 "myb domain protein 16" 0.367 0.358 0.644 2e-40
TAIR|locus:2057931 RAX2 "REGULATOR OF AXILLARY MERISTEMS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 585 (211.0 bits), Expect = 6.1e-66, Sum P(2) = 6.1e-66
 Identities = 104/118 (88%), Positives = 110/118 (93%)

Query:     1 MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLN 60
             MGRAPCCDKANVK+GPWSPEEDAKLK+YIEK GTGGNWIALPHKAGL RCGKSCRLRWLN
Sbjct:     1 MGRAPCCDKANVKRGPWSPEEDAKLKDYIEKQGTGGNWIALPHKAGLRRCGKSCRLRWLN 60

Query:    61 YLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLI 118
             YLRPNI HG+F+++ED II SLFASIGSRWS IAA L GRTDNDIKNYWNTKLKKKLI
Sbjct:    61 YLRPNIRHGDFTEEEDNIIYSLFASIGSRWSVIAAHLQGRTDNDIKNYWNTKLKKKLI 118
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0005515 "protein binding" evidence=IPI
GO:0009785 "blue light signaling pathway" evidence=IMP
TAIR|locus:2174557 MYB36 "myb domain protein 36" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169970 MYB68 "myb domain protein 68" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2097335 MYB84 "myb domain protein 84" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181146 MYB37 "myb domain protein 37" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137589 MYB87 "myb domain protein 87" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161820 MYB80 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088957 TDF1 "DEFECTIVE IN MERISTEM DEVELOPMENT AND FUNCTION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098906 MYB17 "myb domain protein 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150891 MYB16 "myb domain protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00000629001
SubName- Full=Chromosome chr8 scaffold_106, whole genome shotgun sequence; (342 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 2e-43
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 3e-43
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-13
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 1e-12
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 6e-11
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 1e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 1e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-07
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 2e-04
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information 
 Score =  154 bits (390), Expect = 2e-43
 Identities = 72/117 (61%), Positives = 87/117 (74%), Gaps = 1/117 (0%)

Query: 1   MGRAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLN 60
           MGR  CC K  ++KG WSPEED KL  +I K G G  W ++P +AGL RCGKSCRLRW+N
Sbjct: 1   MGRHSCCYKQKLRKGLWSPEEDEKLLRHITKYGHGC-WSSVPKQAGLQRCGKSCRLRWIN 59

Query: 61  YLRPNINHGEFSDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKL 117
           YLRP++  G FS  E+ +I  L A +G+RWS IAAQLPGRTDN+IKN WN+ LKKKL
Sbjct: 60  YLRPDLKRGTFSQQEENLIIELHAVLGNRWSQIAAQLPGRTDNEIKNLWNSCLKKKL 116

Length = 459
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
PLN03212249 Transcription repressor MYB5; Provisional 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.79
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.67
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.62
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.55
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.45
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.43
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.38
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.28
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.25
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.23
PLN03212249 Transcription repressor MYB5; Provisional 99.14
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.11
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.97
PLN03091 459 hypothetical protein; Provisional 98.95
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.91
KOG0051607 consensus RNA polymerase I termination factor, Myb 98.76
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.7
COG5147512 REB1 Myb superfamily proteins, including transcrip 98.34
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.62
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.56
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.5
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.47
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.25
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.18
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.12
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 96.92
PRK13923170 putative spore coat protein regulator protein YlbO 96.75
KOG1279506 consensus Chromatin remodeling factor subunit and 96.71
KOG1279506 consensus Chromatin remodeling factor subunit and 96.63
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.58
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.48
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.43
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 95.84
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.83
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.77
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.31
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.1
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.04
PRK13923170 putative spore coat protein regulator protein YlbO 93.8
KOG4282345 consensus Transcription factor GT-2 and related pr 92.94
KOG1194534 consensus Predicted DNA-binding protein, contains 92.85
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 92.62
KOG2656445 consensus DNA methyltransferase 1-associated prote 92.21
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 92.16
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 92.15
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 90.0
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 89.44
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 87.09
KOG4167907 consensus Predicted DNA-binding protein, contains 82.53
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 81.49
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.8e-37  Score=285.49  Aligned_cols=116  Identities=56%  Similarity=1.191  Sum_probs=111.9

Q ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHhCCCCCceeecccccccccCCccccccccccCCCCCCCCCCHHHHHHHHHH
Q 020997            3 RAPCCDKANVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSL   82 (318)
Q Consensus         3 r~~~~~Kp~lkKG~WT~EEDe~L~~lV~kyG~~~~W~~Ia~~lg~~Rt~kQCreRW~n~L~P~ikk~~WT~EED~~Llel   82 (318)
                      |+|||.|++++|++||+|||++|+++|++||. .+|..||+.++++|+++|||+||.++|+|.+++++||+|||++|+++
T Consensus        14 ~~pcc~K~glKRg~WT~EEDe~L~~lV~kyG~-~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLlel   92 (249)
T PLN03212         14 TTPCCTKMGMKRGPWTVEEDEILVSFIKKEGE-GRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRL   92 (249)
T ss_pred             CCCCcccCCCcCCCCCHHHHHHHHHHHHHhCc-ccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHHHH
Confidence            68999999999999999999999999999998 69999999987789999999999999999999999999999999999


Q ss_pred             HHHhCCchHHHhhhCCCCCHHHHHHHHHHHHHhhhhc
Q 020997           83 FASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKLIG  119 (318)
Q Consensus        83 v~k~G~kWs~IAk~LpgRT~nq~KnRW~~llrkk~~~  119 (318)
                      +.+||++|+.||++|||||+++|||||+.++++++.+
T Consensus        93 ~~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r  129 (249)
T PLN03212         93 HRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLR  129 (249)
T ss_pred             HHhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHh
Confidence            9999999999999999999999999999999988664

>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-21
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 3e-20
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 3e-20
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 3e-20
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 5e-20
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 2e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 1e-13
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 1e-09
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-08
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 3e-08
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 5e-05
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 7e-05
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 2e-04
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 2/104 (1%)
Query: 14  KGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSD 73
           KGPW+ EED K+ E ++K GT    +   H  G  R GK CR RW N+L P +    +++
Sbjct: 7   KGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKG--RLGKQCRERWHNHLNPEVKKSSWTE 64
Query: 74  DEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKL 117
           +EDRII      +G+RW+ IA  LPGRTDN +KN+WN+ +K+K+
Sbjct: 65  EEDRIIFEAHKVLGNRWAEIAKLLPGRTDNAVKNHWNSTIKRKV 108
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 3e-60
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 4e-60
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 4e-60
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 9e-60
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-52
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 3e-51
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 1e-25
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-24
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 8e-20
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 2e-16
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 4e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-06
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 5e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 1e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 1e-06
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 1e-06
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-05
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 3e-05
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 4e-05
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 5e-05
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 1e-04
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 1e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  186 bits (476), Expect = 3e-60
 Identities = 43/106 (40%), Positives = 66/106 (62%), Gaps = 2/106 (1%)

Query: 12  VKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEF 71
           + KGPW+ EED ++ + ++K G    W  +       R GK CR RW N+L P +    +
Sbjct: 2   LIKGPWTKEEDQRVIKLVQKYGPK-RWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSW 59

Query: 72  SDDEDRIICSLFASIGSRWSTIAAQLPGRTDNDIKNYWNTKLKKKL 117
           +++EDRII      +G+RW+ IA  LPGRTDN IKN+WN+ +++K+
Sbjct: 60  TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV 105
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 100.0
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.83
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.82
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.75
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.74
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.69
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.68
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.67
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.66
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.64
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.63
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.63
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.62
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.62
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.6
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.6
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.59
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.58
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.58
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.56
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.55
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.55
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.55
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.55
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.51
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.26
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.5
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.49
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.48
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.44
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.41
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.39
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.37
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.35
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.34
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.34
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.34
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.32
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.32
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.3
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.29
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.29
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.28
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.28
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.93
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.24
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.22
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.21
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.21
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.98
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.98
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.84
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.83
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.72
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.61
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.57
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.54
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.39
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.38
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.28
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.23
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.22
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.18
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.12
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.39
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.04
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.98
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.91
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.88
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.62
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.58
2crg_A70 Metastasis associated protein MTA3; transcription 97.56
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.4
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.22
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.2
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.1
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.94
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.63
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.55
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 96.34
2crg_A70 Metastasis associated protein MTA3; transcription 96.34
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 95.52
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 93.86
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 93.48
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 92.76
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 92.02
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 91.92
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 86.72
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 82.17
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
Probab=100.00  E-value=2e-34  Score=233.58  Aligned_cols=105  Identities=41%  Similarity=0.866  Sum_probs=99.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHhCCCCCceeecccccccccCCccccccccccCCCCCCCCCCHHHHHHHHHHHHHhCCch
Q 020997           11 NVKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFASIGSRW   90 (318)
Q Consensus        11 ~lkKG~WT~EEDe~L~~lV~kyG~~~~W~~Ia~~lg~~Rt~kQCreRW~n~L~P~ikk~~WT~EED~~Llelv~k~G~kW   90 (318)
                      .++||+||+|||++|+++|++||. .+|..||+.++ +|+++||++||.++|+|.+++++||+|||.+|++++.+||++|
T Consensus         1 ~l~k~~WT~eED~~L~~~v~~~g~-~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~Wt~eEd~~L~~~~~~~G~~W   78 (105)
T 1gv2_A            1 ELIKGPWTKEEDQRVIKLVQKYGP-KRWSVIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRW   78 (105)
T ss_dssp             CCCCSCCCHHHHHHHHHHHHHHCT-TCHHHHHTTST-TCCHHHHHHHHHHTTCCCCCCCCCCHHHHHHHHHHHHHHSSCH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHhCC-CcHHHHhhhhc-CCCHHHHHHHHHhccCCcccccCCCHHHHHHHHHHHHHhCCCH
Confidence            478999999999999999999998 58999999997 9999999999999999999999999999999999999999999


Q ss_pred             HHHhhhCCCCCHHHHHHHHHHHHHhhh
Q 020997           91 STIAAQLPGRTDNDIKNYWNTKLKKKL  117 (318)
Q Consensus        91 s~IAk~LpgRT~nq~KnRW~~llrkk~  117 (318)
                      +.||++|||||+++|++||+.++++++
T Consensus        79 ~~Ia~~l~gRt~~~~k~rw~~~~~~~~  105 (105)
T 1gv2_A           79 AEIAKLLPGRTDNAIKNHWNSTMRRKV  105 (105)
T ss_dssp             HHHHTTCTTCCHHHHHHHHHHHTC---
T ss_pred             HHHHHHcCCCCHHHHHHHHHHHHhccC
Confidence            999999999999999999999998763
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-08
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 7e-18
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 4e-17
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-09
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 1e-15
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-05
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 1e-14
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 6e-14
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-12
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 4e-09
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 3e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-06
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-04
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-09
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-08
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 1e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 4e-05
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 75.9 bits (187), Expect = 1e-18
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 12 VKKGPWSPEEDAKLKEYIEKNGTGGNWIALPHKAGLMRCGKSCRLRWLNYLRP 64
          + KGPW+ EED +L + ++K G    W  +  K    R GK CR RW N+L P
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGP-KRWSVIA-KHLKGRIGKQCRERWHNHLNP 51
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.71
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.69
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.63
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.56
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.55
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.5
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.5
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.49
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.45
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.45
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.4
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.39
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.37
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.36
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.34
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.34
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.3
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.28
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.25
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.22
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.15
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.13
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.04
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.8
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.8
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.65
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.14
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.06
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.66
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.43
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.21
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.98
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.57
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.51
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 95.16
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 92.88
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 89.25
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 87.9
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 85.97
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.71  E-value=1.5e-20  Score=147.02  Aligned_cols=71  Identities=21%  Similarity=0.226  Sum_probs=64.7

Q ss_pred             CCCCCHHHHHHHHHHHHHhCCC----CCceeecccccccccCCccccccccccCCCCCCCCCCHHHHHHHHHHHHH
Q 020997           14 KGPWSPEEDAKLKEYIEKNGTG----GNWIALPHKAGLMRCGKSCRLRWLNYLRPNINHGEFSDDEDRIICSLFAS   85 (318)
Q Consensus        14 KG~WT~EEDe~L~~lV~kyG~~----~~W~~Ia~~lg~~Rt~kQCreRW~n~L~P~ikk~~WT~EED~~Llelv~k   85 (318)
                      |++||+|||++|+++|.+||..    .+|..||+.|+ +||++|||+||.++|+|.+++++||++||.+|+.+...
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~~   75 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGN   75 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTSC
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhhc
Confidence            6899999999999999999972    14999999998 99999999999999999999999999999998865543
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure