Citrus Sinensis ID: 021007


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MGVDIESLSEATSGAIGSLLSTTILYPLDTCKTKYQAEVRAHGQQKYRKLSDVLWEAISNGQVHSLYQGLGTKNLQSFISQFVYFYGYSYFKRLYLKRSGNKSIGTKANLIIAATAGACTAIITQPLDTASSRMQTSAFGKSKGLWKTLTEGTWSDAFDGLGISLLLTSNPAIQYTVFDQLKRRMLKGKQNKAGGTSPQALSAFAAFVLGAVSKSIATVLTYPAIRCKVMIQAADPNENGTEKTQPRSRKTLAGVVCAIWKREGVLGFFKGLHAQILKTVLSSALLLMIKEKIAATTWVLILAIRRYLFLTRGRLKSA
ccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccHHHHHcccccHHccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
****IESLSEATSGAIGSLLSTTILYPLDTCKTKYQAEVRAHGQQKYRKLSDVLWEAISNGQVHSLYQGLGTKNLQSFISQFVYFYGYSYFKRLYLKRSGNKSIGTKANLIIAATAGACTAIITQPLDTASSRMQTSAFGKSKGLWKTLTEGTWSDAFDGLGISLLLTSNPAIQYTVFDQLKRRML*************ALSAFAAFVLGAVSKSIATVLTYPAIRCKVMIQA****************KTLAGVVCAIWKREGVLGFFKGLHAQILKTVLSSALLLMIKEKIAATTWVLILAIRRYLFLTR******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHxxxHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVDIESLSEATSGAIGSLLSTTILYPLDTCKTKYQAEVRAHGQQKYRKLSDVLWEAISNGQVHSLYQGLGTKNLQSFISQFVYFYGYSYFKRLYLKRSGNKSIGTKANLIIAATAGACTAIITQPLDTASSRMQTSAFGKSKGLWKTLTEGTWSDAFDGLGISLLLTSNPAIQYTVFDQLKRRMLKGKQNKAGGTSPQALSAFAAFVLGAVSKSIATVLTYPAIRCKVMIQAADPNENGTEKTQPRSRKTLAGVVCAIWKREGVLGFFKGLHAQILKTVLSSALLLMIKEKIAATTWVLILAIRRYLFLTRGRLKSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisomal adenine nucleotide carrier 1 Peroxisomal adenine nucleotide transporter catalyzing the counterexchange of ATP with AMP. ATP is needed by reactions that generate acyl-CoA for peroxisomal fatty acid beta-oxidation during postgerminative growth. Required for the beta-oxidation reactions involved in auxin biosynthesis and for the conversion of seed-reserved triacylglycerols into sucrose that is necessary for growth before the onset of photosynthesis.confidentQ9MA90
Peroxisomal adenine nucleotide carrier 1 Peroxisomal adenine nucleotide transporter catalyzing the counterexchange of ATP with AMP. ATP is needed by reactions that generate acyl-CoA for peroxisomal fatty acid beta-oxidation during postgerminative growth. Required for the conversion of seed-reserved triacylglycerols into sucrose that is necessary for growth before the onset of photosynthesis.confidentB6ZJZ9
Peroxisomal membrane protein PMP34 Peroxisomal transporter for multiple cofactors like coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN) and nucleotide adenosine monophosphate (AMP), and to a lesser extend for nicotinamide adenine dinucleotide (NAD(+)), adenosine diphosphate (ADP) and adenosine 3',5'-diphosphate (PAP). May catalyze the transport of free CoA, FAD and NAD(+) from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. Inhibited by pyridoxal 5'-phosphate and bathophenanthroline in vitro.probableO70579

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OKC, chain A
Confidence level:very confident
Coverage over the Query: 4-189,200-293
View the alignment between query and template
View the model in PyMOL