Citrus Sinensis ID: 021017

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MKNSNSNTKLILLHPYIQKQGTSNRLWLLAFVSFFTIAFLLTLIYTRESISLKTTSGSAATMDTKSTSSVSAGFGNPPLPTTVINTLLLYASRSNDSYHMTHSELKRISDVIRKCSSPCNFLVFGLTQETLLWKALNHNGRTVFIDENRYYAAYFEELHPEIDVFDVQYTTKIRETKELIASAKEQIRNECKPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPDGPGRMSPIFTAGVLARSKKGGNPKTHIFVHDYYRHVERMCGDEFLCKENLVEFNDMLAHFVLEKMDENSFEFCRNNNASSRASASS
ccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHcccccEEEECccHHHHHHHHHHccccEEEEEEEEccHHcHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEEcccccccccccccccHHHcHHHHHHHccccccccEEEEEcccHHHHHHHHHHHccccccccccccEEEEEEcccccccccccccccccccccccc
********KLILLHPYIQKQGTSNRLWLLAFVSFFTIAFLLTLIYTRESI****************************LPTTVINTLLLYASRSNDSYHMTHSELKRISDVIRKCSSPCNFLVFGLTQETLLWKALNHNGRTVFIDENRYYAAYFEELHPEIDVFDVQYTTKIRETKELIASAKEQIRNECKPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPDGPGRMSPIFTAGVLAR*****NPKTHIFVHDYYRHVERMCGDEFLCKENLVEFNDMLAHFVLEKM*********************
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNSNSNTKLILLHPYIQKQGTSNRLWLLAFVSFFTIAFLLTLIYTRESISLKTTSGSAATMDTKSTSSVSAGFGNPPLPTTVINTLLLYASRSNDSYHMTHSELKRISDVIRKCSSPCNFLVFGLTQETLLWKALNHNGRTVFIDENRYYAAYFEELHPEIDVFDVQYTTKIRETKELIASAKEQIRNECKPVQNLLFSECKLGINDLPNHVYEVDWDVILIDGPRGDGPDGPGRMSPIFTAGVLARSKKGGNPKTHIFVHDYYRHVERMCGDEFLCKENLVEFNDMLAHFVLEKMDENSFEFCRNNNASSRASASS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein IRX15-LIKE Required for xylan biosynthesis, but not directly involved in catalyzing the addition of sugars to the growing polymer.confidentQ9FH92
Protein IRREGULAR XYLEM 15 Required for xylan biosynthesis, but not directly involved in catalyzing the addition of sugars to the growing polymer.probableQ9SNE5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CVO, chain A
Confidence level:probable
Coverage over the Query: 101-296
View the alignment between query and template
View the model in PyMOL
Template: 3C6K, chain A
Confidence level:probable
Coverage over the Query: 116-186,215-295
View the alignment between query and template
View the model in PyMOL