Citrus Sinensis ID: 021042

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32

MAATRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGRPWRDPPVVKETLNAGKSSSRPPLAQSASVGGVGRNGNYGNHGGWDSWDNDDFRSSNDMRRNQSVSDFRGGSGGMGGMPASRSKSTEDIYTRAELEASAANKEGFFSRKIAENEARPEGLPPSQGGKYVGFGSTPPPTQRNTNSQGDVLSAVSQGFGRISLVAASAAQSAATVVQAGTREFTSKLFLSEEDCFYWKKNPRG

cHHHHHHHHHHccccccccccccccccccEEEcccEEEEEcccccccccccEEEEEEccccccccHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccc

***TRRLRDLQSQPGNKICVDCAQKNPQWASVSYGVFMCLECSGKHRGLGVHISFVRSVTMDSWSEIQIKKMEAGGNERLNTFLSQYGIPKETDIVTKYNTNAASIYRDRIQAIAEGR******************************************************************************************************************************************************VSQGFGRISLV************QAGTREFTSKLFLSEEDCFYWK*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ADP-ribosylation factor GTPase-activating protein AGD7	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF). Involved in protein trafficking by controlling ARF1 activity; may participate in COPI vesicle formation at the Golgi complex.	probable	O80925

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O47, chain A
Confidence level:very confident
Coverage over the Query: 3-124
View the alignment between query and template
View the model in PyMOL