Citrus Sinensis ID: 021051


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MDSTDKFTNAFKSSPEMEKFLCDRLVDPTQPISERFRALFSLRNLKGPGPRDALIRATKDSSNLLAHEAAFALGQMQDAEAIPALEAVLNDFSLHPIVRHEAAEALGAIGLESNIPLLKNSLVSDPAQEVRETCELALERIEKLKASGSDGSSMTERSPFMSVDPAAPASSCSSVDMLREVLLGEEKGMYERYAALFALRNHGGDEAVSAIIDSLGATSALLKHEVAYVLGQLQNKAASAALSDVLRNVNEHPMVRHEAAEALGSIADDQSIGLLKEFAKDPEPIVSQSCEVALSMLEYEQLEKSFEYLFMQAPLMQV
ccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHccccccc
*****KF***********KFLCDRLVDPTQPISERFRALFSLRNLKGPGPRDALIRATKDSSNLLAHEAAFALGQMQDAEAIPALEAVLNDFSLHPIVRHEAAEALGAIGLESNIPLLKNSLVSDPAQEVRETCELALERIEKLKASGSDGSSMTERSPFMSVDPAAPASSCSSVDMLREVLLGEEKGMYERYAALFALRNHGGDEAVSAIIDSLGATSALLKHEVAYVLGQLQNKAASAALSDVLRNVNEHPMVRHEAAEALGSIADDQSIGLLKEFAKDPEPIVSQSCEVALSMLEYEQLEKSFEYLFMQAPLM**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSTDKFTNAFKSSPEMEKFLCDRLVDPTQPISERFRALFSLRNLKGPGPRDALIRATKDSSNLLAHEAAFALGQMQDAEAIPALEAVLNDFSLHPIVRHEAAEALGAIGLESNIPLLKNSLVSDPxxxxxxxxxxxxxxxxxxxxxGSDGSSMTERSPFMSVDPAAPASSCSSVDMLREVLLGEEKGMYERYAALFALRNHGGDEAVSAIIDSLGATSALLKHEVAYVLGQLQNKAASAALSDVLRNVNEHPMVRHEAAEALGSIADDQSIGLLKEFAKDPEPIVSQSCEVALSMLEYEQLEKSFEYLFMQAPLMQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Deoxyhypusine hydroxylase Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor.confidentQ94JW0
Deoxyhypusine hydroxylase-A Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor.confidentQ2QXB3
Deoxyhypusine hydroxylase Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor.probableQ5ZIP3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.14.-.-Acting on paired donors, with incorporation or reduction of molecular oxygen.probable
1.14.99.-Miscellaneous (requires further characterization).probable
1.14.99.29Deoxyhypusine monooxygenase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LTJ, chain A
Confidence level:very confident
Coverage over the Query: 12-142,171-234
View the alignment between query and template
View the model in PyMOL
Template: 3LTJ, chain A
Confidence level:very confident
Coverage over the Query: 50-131,193-298
View the alignment between query and template
View the model in PyMOL
Template: 4ADY, chain A
Confidence level:very confident
Coverage over the Query: 33-303
View the alignment between query and template
View the model in PyMOL
Template: 3TPO, chain A
Confidence level:confident
Coverage over the Query: 15-154,169-318
View the alignment between query and template
View the model in PyMOL