Citrus Sinensis ID: 021061
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| 356505250 | 329 | PREDICTED: uncharacterized protein LOC10 | 0.927 | 0.896 | 0.494 | 7e-72 | |
| 356570770 | 335 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.898 | 0.5 | 2e-68 | |
| 224140221 | 330 | predicted protein [Populus trichocarpa] | 0.959 | 0.924 | 0.538 | 4e-68 | |
| 413968366 | 324 | hypothetical protein [Phaseolus vulgaris | 0.924 | 0.907 | 0.471 | 4e-67 | |
| 255556920 | 345 | metal ion binding protein, putative [Ric | 0.930 | 0.857 | 0.505 | 3e-65 | |
| 449482425 | 326 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.923 | 0.495 | 3e-65 | |
| 449451040 | 326 | PREDICTED: uncharacterized protein LOC10 | 0.946 | 0.923 | 0.492 | 1e-64 | |
| 388495726 | 343 | unknown [Lotus japonicus] | 0.955 | 0.886 | 0.478 | 1e-61 | |
| 356548272 | 331 | PREDICTED: uncharacterized protein LOC54 | 0.974 | 0.936 | 0.513 | 1e-60 | |
| 18404283 | 386 | heavy-metal-associated domain-containing | 0.889 | 0.733 | 0.497 | 4e-60 |
| >gi|356505250|ref|XP_003521405.1| PREDICTED: uncharacterized protein LOC100792662 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 276 bits (707), Expect = 7e-72, Method: Compositional matrix adjust.
Identities = 174/352 (49%), Positives = 219/352 (62%), Gaps = 57/352 (16%)
Query: 1 MGEQNEGDKKAAGAAADAGGKKDDGVVTVVLKVDLHCEGCAKKIKRAMKNYEGVVDVKTD 60
MGE+ E K ++G K++DG + VVLK+D+HCEGC KKIKRA+++++GV DVKTD
Sbjct: 1 MGEKKEAAKNEGDKKPESGAKQNDGRLPVVLKLDMHCEGCVKKIKRAVRHFDGVEDVKTD 60
Query: 61 CGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKSEEKSEKKPDDKKS 120
+ K+TV GKV+PAK++++L KTKKKV+L+SPQPKKD+ G + E+KSE+K + K
Sbjct: 61 LSSKKLTVIGKVDPAKVRDKLAEKTKKKVELISPQPKKDSAGDKPPEEKKSEEKKPEDKK 120
Query: 121 EEKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELV 180
E+K PKESTVVLKIRLHCEGCI KI+KII KTKGV++V I+GGKDLV+VKGTMDVKE+V
Sbjct: 121 AEEKTPKESTVVLKIRLHCEGCIQKIRKIILKTKGVESVNIEGGKDLVSVKGTMDVKEIV 180
Query: 181 PYLKEKLKRNVEVVPAKKDDGEKKENKDADKGGDKKAKEAAPATDKGGEKKEKEAAAAGG 240
PYL EKLKRNVEVVP KK+ G DK K++ G
Sbjct: 181 PYLNEKLKRNVEVVPPKKEGG-----------------------DKKENNKKEGGGGGGA 217
Query: 241 GDGGKVEVHKMEYYGYPYPPAPSYWYDNHVYG------------QSYPMENQHQVVYANQ 288
KVEV+KME+YGY YP YW+ + Y SY +E Q Y+NQ
Sbjct: 218 EGAAKVEVNKMEHYGYAYPAPHMYWHGHGGYAPGESSSSSSSSNNSYEVEVQSGYSYSNQ 277
Query: 289 GY----------------------PPQMHHAPPMYHAPQMFSDENPNACSVM 318
GY PP + P + PQMFSDENPNACSVM
Sbjct: 278 GYDGNYVNYPYQHGYNDNYMAMAQPPPPFYLNPHHPPPQMFSDENPNACSVM 329
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356570770|ref|XP_003553557.1| PREDICTED: uncharacterized protein LOC100795652 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224140221|ref|XP_002323483.1| predicted protein [Populus trichocarpa] gi|222868113|gb|EEF05244.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|413968366|gb|AFW90521.1| hypothetical protein [Phaseolus vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|255556920|ref|XP_002519493.1| metal ion binding protein, putative [Ricinus communis] gi|223541356|gb|EEF42907.1| metal ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449482425|ref|XP_004156278.1| PREDICTED: uncharacterized protein LOC101231228 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449451040|ref|XP_004143270.1| PREDICTED: uncharacterized protein LOC101221463 isoform 1 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388495726|gb|AFK35929.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356548272|ref|XP_003542527.1| PREDICTED: uncharacterized protein LOC547884 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18404283|ref|NP_565855.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|20197942|gb|AAD31580.2| putative farnesylated protein [Arabidopsis thaliana] gi|330254231|gb|AEC09325.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 318 | ||||||
| TAIR|locus:2057951 | 386 | AT2G36950 [Arabidopsis thalian | 0.506 | 0.417 | 0.481 | 2.6e-45 | |
| TAIR|locus:2142614 | 392 | AT5G03380 [Arabidopsis thalian | 0.210 | 0.170 | 0.611 | 2.2e-40 | |
| TAIR|locus:2163300 | 290 | AT5G50740 [Arabidopsis thalian | 0.194 | 0.213 | 0.539 | 1.2e-30 | |
| TAIR|locus:2167366 | 355 | FP3 "farnesylated protein 3" [ | 0.194 | 0.174 | 0.507 | 9.8e-30 | |
| TAIR|locus:2075497 | 246 | AT3G02960 "AT3G02960" [Arabido | 0.191 | 0.247 | 0.387 | 2.3e-27 | |
| TAIR|locus:2046183 | 245 | AT2G28090 [Arabidopsis thalian | 0.471 | 0.612 | 0.360 | 1.2e-24 | |
| TAIR|locus:2153969 | 319 | AT5G24580 "AT5G24580" [Arabido | 0.194 | 0.194 | 0.403 | 4.8e-24 | |
| TAIR|locus:2018768 | 287 | AT1G29000 [Arabidopsis thalian | 0.490 | 0.543 | 0.275 | 2.6e-23 | |
| TAIR|locus:2133544 | 150 | AT4G08570 "AT4G08570" [Arabido | 0.176 | 0.373 | 0.456 | 7.9e-14 | |
| TAIR|locus:2026336 | 152 | HIPP20 "heavy metal associated | 0.176 | 0.368 | 0.385 | 7.9e-14 |
| TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 369 (135.0 bits), Expect = 2.6e-45, Sum P(2) = 2.6e-45
Identities = 79/164 (48%), Positives = 96/164 (58%)
Query: 35 LHCEGCAKKIKRAMKNYEGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSP 94
+HCEGCAKKIKR +K+++GV DV D G NK+ V GK++P KL+E+LE KTK+KV L +P
Sbjct: 58 MHCEGCAKKIKRMVKHFDGVKDVTADTGGNKLLVVGKIDPVKLQEKLEEKTKRKVVLANP 117
Query: 95 QPXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXXXXSTVVLKIRLHCEGCXXXXXXXXXX 152
P S V LKIRLHCEGC
Sbjct: 118 PPKVEGPVAAAVGEKKADGGDKEAAPPAPAPAAPKESVVPLKIRLHCEGCIQKIKKIILK 177
Query: 153 XXGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVE-VVP 195
GV+ V IDG KD+VTVKGT+DVKELVP L +KLKR VE +VP
Sbjct: 178 IKGVETVAIDGAKDVVTVKGTIDVKELVPLLTKKLKRTVEPLVP 221
|
|
| TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133544 AT4G08570 "AT4G08570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2026336 HIPP20 "heavy metal associated isoprenylated plant protein 20" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 4e-09 | |
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 1e-07 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 1e-07 | |
| COG2608 | 71 | COG2608, CopZ, Copper chaperone [Inorganic ion tra | 0.002 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 0.003 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
Score = 51.8 bits (125), Expect = 4e-09
Identities = 22/62 (35%), Positives = 33/62 (53%)
Query: 29 VVLKVDLHCEGCAKKIKRAMKNYEGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKK 88
+ + C GCAKK+++A+ GV V D KVTVTG +P KL++ +A K
Sbjct: 1 TLRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLETGKVTVTGDPDPLKLEKLKKAIEKAG 60
Query: 89 VD 90
+
Sbjct: 61 YE 62
|
Length = 62 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >gnl|CDD|225328 COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 99.27 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.18 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.15 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 99.13 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.03 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.99 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 98.89 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 98.84 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 98.83 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.52 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.38 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.9 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 97.57 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.52 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 97.32 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.05 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 97.02 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 96.71 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 94.94 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 92.55 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 87.3 |
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
Probab=99.27 E-value=1.2e-10 Score=122.76 Aligned_cols=161 Identities=19% Similarity=0.343 Sum_probs=113.0
Q ss_pred ceEEEEEEE-eeCHHHHHHHHHHHhcCCCeeEEEEecCCCEEEEeccCCHHHHHHHHHhcccCcccccCCCCCCCCCCCC
Q 021061 26 VVTVVLKVD-LHCEGCAKKIKRAMKNYEGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGE 104 (318)
Q Consensus 26 ~~~v~lkV~-m~C~~Ca~kIe~~L~~l~GV~~v~v~~~~~~v~V~~~~~~~~i~~~i~~~~~~~~~~~~~~~~~~~~~~~ 104 (318)
+.+++|.|+ |+|.+|+.+|+++|++++||..+.+++. +.+|....+...+...|++. ++.+.+.++..........
T Consensus 2 ~~~~~l~V~gmtC~~C~~~i~~al~~~~gv~~v~v~~~--~~~v~~~~~~~~i~~~i~~~-Gy~~~~~~~~~~~~~~~~~ 78 (834)
T PRK10671 2 SQTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSIT--EAHVTGTASAEALIETIKQA-GYDASVSHPKAKPLTESSI 78 (834)
T ss_pred CeEEEEEECCcccHHHHHHHHHHHhcCCCcceEEEeee--EEEEEecCCHHHHHHHHHhc-CCccccccccccccccccc
Confidence 356899999 9999999999999999999999999984 56666667888999999854 4466554321111000000
Q ss_pred CcccccccCCCCCCCcccCCCCCcceEEEEE-eechhhhHHHHHHHhhcCCCccEEeecCCCCeEEEEecCCHHHHHHHH
Q 021061 105 KKSEEKSEKKPDDKKSEEKKPPKESTVVLKI-RLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYL 183 (318)
Q Consensus 105 ~~~~~~~~~k~~~~~~~~~~~~~~~~~~l~v-gm~C~~C~~kI~k~l~~~~GV~sv~vd~~~~~v~V~g~~d~~~l~~~l 183 (318)
. .+.....+. ..+.. ......++.|.| ||+|..|+..|++.+..++||.++.+++.++++.|.+..+...+...+
T Consensus 79 ~-~~~~~~~~~--~~~~~-~~~~~~~~~l~V~Gm~Ca~Ca~~Ie~~L~~~~GV~~a~vnl~t~~~~V~~~~s~~~I~~~I 154 (834)
T PRK10671 79 P-SEALTAASE--ELPAA-TADDDDSQQLLLSGMSCASCVSRVQNALQSVPGVTQARVNLAERTALVMGSASPQDLVQAV 154 (834)
T ss_pred C-chhhhhhhh--hcccc-ccCcCceEEEEeCCcCcHHHHHHHHHHHhcCCCceeeeeecCCCeEEEEccCCHHHHHHHH
Confidence 0 000000000 00000 001123577889 999999999999999999999999999999998887667788888888
Q ss_pred HHhcCCCeEEc
Q 021061 184 KEKLKRNVEVV 194 (318)
Q Consensus 184 ~~k~g~~a~~v 194 (318)
+ .+|+.+.++
T Consensus 155 ~-~~Gy~a~~~ 164 (834)
T PRK10671 155 E-KAGYGAEAI 164 (834)
T ss_pred H-hcCCCcccc
Confidence 8 888876543
|
|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 318 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 1e-14 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 3e-10 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 9e-12 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 1e-11 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 2e-08 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 2e-11 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 2e-06 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 4e-10 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 5e-06 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 5e-10 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 1e-07 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 2e-07 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 2e-07 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 5e-04 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 1e-06 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 4e-06 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 7e-04 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 2e-05 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 5e-05 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 6e-05 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 1e-04 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 1e-04 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 3e-04 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 3e-04 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 4e-04 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 67.9 bits (166), Expect = 1e-14
Identities = 15/94 (15%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
Query: 10 KAAGAAADAGGKKDDGVVTVVLKVDLHCEGCAKKIKRAMKNYEGVVDVKTDCGANKVTVT 69
+ + + + T+ V + C+ C ++++++ GV DV+ V V
Sbjct: 2 SSGSSGMASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVH 61
Query: 70 GKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGG 103
+ +++ LE T ++ L + G
Sbjct: 62 TTLPSQEVQALLE-GTGRQAVLKGMGSGQLQNSG 94
|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A Length = 64 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} Length = 85 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A Length = 151 | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A Length = 66 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A Length = 69 | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} Length = 71 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A Length = 90 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A Length = 72 | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A Length = 75 | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} Length = 66 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A Length = 79 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.77 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.73 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.71 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.32 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.2 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.12 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.1 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.1 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.08 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.0 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.99 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.98 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.97 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 98.97 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 98.96 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 98.96 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.87 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.87 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.87 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.87 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.85 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 98.84 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.84 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.83 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.83 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.83 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.82 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.8 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.79 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.77 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.77 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.77 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.74 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.73 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.72 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 98.7 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.7 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 98.69 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.69 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.68 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 98.68 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.67 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 98.67 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.67 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 98.66 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 98.66 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 98.64 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 98.64 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 98.64 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.6 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 98.59 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 98.58 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 98.58 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 98.57 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 98.55 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 98.55 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 98.54 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 98.52 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 98.52 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 98.52 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.51 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 98.51 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 98.49 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 98.49 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 98.48 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.47 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 98.44 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 98.44 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 98.41 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.37 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.36 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.28 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.25 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.17 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.87 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 97.64 |
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.77 E-value=1.1e-17 Score=137.39 Aligned_cols=138 Identities=14% Similarity=0.353 Sum_probs=114.3
Q ss_pred ceEEEEEEE-eeCHHHHHHHHHHHhcCCCeeEEEEecCCCEEEEec---cCCHHHHHHHHHhcccCcccccCCCCCCCCC
Q 021061 26 VVTVVLKVD-LHCEGCAKKIKRAMKNYEGVVDVKTDCGANKVTVTG---KVEPAKLKERLEAKTKKKVDLVSPQPKKDAG 101 (318)
Q Consensus 26 ~~~v~lkV~-m~C~~Ca~kIe~~L~~l~GV~~v~v~~~~~~v~V~~---~~~~~~i~~~i~~~~~~~~~~~~~~~~~~~~ 101 (318)
|.++.|.|. |+|.+|+.+|+++|..++||..+.+++.+++++|.. ..+...|...|...++ .+.++....
T Consensus 3 ~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~~~G~-~~~~~~~~~----- 76 (149)
T 2ew9_A 3 PQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQDLGF-EAAVMEDYA----- 76 (149)
T ss_dssp CEEEEEEEECCCSSSHHHHHHHHHHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHHHHTC-EEEECSCSC-----
T ss_pred cEEEEEEECCeecHHHHHHHHHHHhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHhcCCC-ceEeecccc-----
Confidence 567889999 999999999999999999999999999999999874 3567788888885554 433221100
Q ss_pred CCCCcccccccCCCCCCCcccCCCCCcceEEEEE-eechhhhHHHHHHHhhcCCCccEEeecCCCCeEEEEec---CCHH
Q 021061 102 GGEKKSEEKSEKKPDDKKSEEKKPPKESTVVLKI-RLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGT---MDVK 177 (318)
Q Consensus 102 ~~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~l~v-gm~C~~C~~kI~k~l~~~~GV~sv~vd~~~~~v~V~g~---~d~~ 177 (318)
.....+.|.| ||+|.+|+.+|+++|.+++||.++.+|+.+++++|... ++..
T Consensus 77 ------------------------~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~ 132 (149)
T 2ew9_A 77 ------------------------GSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPR 132 (149)
T ss_dssp ------------------------CSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHH
T ss_pred ------------------------cccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHH
Confidence 1123678999 99999999999999999999999999999999999743 6788
Q ss_pred HHHHHHHHhcCCCeEEc
Q 021061 178 ELVPYLKEKLKRNVEVV 194 (318)
Q Consensus 178 ~l~~~l~~k~g~~a~~v 194 (318)
.|...|. ++||.+.++
T Consensus 133 ~i~~~i~-~~Gy~~~~~ 148 (149)
T 2ew9_A 133 DIIKIIE-EIGFHASLA 148 (149)
T ss_dssp HHHHHHH-HHTCEEECC
T ss_pred HHHHHHH-hCCCceEec
Confidence 9999999 999987654
|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 318 | ||||
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 2e-11 | |
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 9e-07 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 1e-09 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 1e-05 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-09 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 4e-04 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 5e-09 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 6e-05 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-08 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 6e-04 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-08 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 5e-04 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 2e-08 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 7e-05 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 3e-08 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 1e-04 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 9e-08 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 6e-04 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 6e-07 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 0.004 | |
| d1cpza_ | 68 | d.58.17.1 (A:) Copper chaperone {Enterococcus hira | 7e-07 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 8e-07 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 4e-06 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 0.002 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 2e-04 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 0.003 |
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone for superoxide dismutase, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 56.7 bits (137), Expect = 2e-11
Identities = 14/61 (22%), Positives = 24/61 (39%)
Query: 23 DDGVVTVVLKVDLHCEGCAKKIKRAMKNYEGVVDVKTDCGANKVTVTGKVEPAKLKERLE 82
+ + +HCE C IK +KN G+ + D ++V V P+ + L
Sbjct: 2 TNDTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLR 61
Query: 83 A 83
Sbjct: 62 N 62
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} Length = 68 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 318 | |||
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.47 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.43 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.42 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.37 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.34 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.34 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.34 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.33 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.32 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.31 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.31 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.28 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.27 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.26 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.24 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.23 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.2 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.18 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.15 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.14 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.13 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.13 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.11 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.09 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.08 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.05 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.01 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 98.99 |
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Human (Homo sapiens), HAH1 [TaxId: 9606]
Probab=99.47 E-value=7.4e-14 Score=98.35 Aligned_cols=64 Identities=22% Similarity=0.423 Sum_probs=60.6
Q ss_pred eEEEEEeechhhhHHHHHHHhhcCCCccEEeecCCCCeEEEEecCCHHHHHHHHHHhcCCCeEEcc
Q 021061 130 TVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVVP 195 (318)
Q Consensus 130 ~~~l~vgm~C~~C~~kI~k~l~~~~GV~sv~vd~~~~~v~V~g~~d~~~l~~~l~~k~g~~a~~v~ 195 (318)
+.+|+|+|+|.+|+.+|+++|.+++|| ++.+|+.+++++|.++++++.|+++|+ ++||.|+++.
T Consensus 2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~-~~Gy~a~lig 65 (66)
T d1fe0a_ 2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLK-KTGKTVSYLG 65 (66)
T ss_dssp EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHH-TTTSCEEEEE
T ss_pred CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHH-HhCCeEEEee
Confidence 468999999999999999999999998 699999999999999999999999999 9999999874
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|