Citrus Sinensis ID: 021063


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MIMGSSSNDHQNNQIVKGKRTKRQRSTSPFGFAVTDSSSSGNNSGADESYYSNNNNNNSVMSFPTTSGESTEEEDQDMANCLIMLAQGDDRSRQINQENIIDDKVQKFNASRKFTTAVTSNNKAGAGGFYVYECKTCNRSFPSFQALGGHRASHKKPKAALAEAPEKKSSASVPALAVLPTKNEYKDSYSTLHHHDQSHMQAASAAATAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRHRAAVATGNNINQVATIESNIGDVKPVAATRSILPLDLNLPAPEDDHHIRFGATQQSLVFSAPALVDCHY
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEcccccccEEEEEcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEcccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccEccccccccccc
mimgsssndhqnnqivkgkrtkrqrstspfgfavtdssssgnnsgadesyysnnnnnnsvmsfpttsgesteeeDQDMANCLIMLAQgddrsrqinQENIIDDKVQKFNASRKFTTavtsnnkagaggfyvyecktcnrsfpsfqalgghrashkkpkaalaeapekkssasvpalavlptkneykdsystlhhhdQSHMQAASAAATAannnntannnnkggnkihecsicgseftsgqalgghmrRHRAavatgnninqVATIesnigdvkpvaatrsilpldlnlpapeddhhirfgatqqslvfsapalvdchy
mimgsssndhqnnqivkgkrtkrqrstspfgfavtdssssgnnSGADESYYSNNNNNNSVMSFPTTSGESTEEEDQDMANCLIMLAQGDDRSRQINQEniiddkvqkfnASRKFTtavtsnnkagagGFYVYECKTCNRSFPSFQALGGHRASHKKPKAALaeapekkssasvpalavlpTKNEYKDSYSTLHHHDQSHMQAASAAATAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRHRAAVATGNNINQVATIESNIGDVKPVAATRSILPLDLNLPAPEDDHHIRFGATQQSLvfsapalvdchy
MIMGSSSNDHQNNQIVKGKRTKRQRSTSPFGFAVTDssssgnnsgADEsyysnnnnnnsVMSFPTTSGESTEEEDQDMANCLIMLAQGDDRSRQINQENIIDDKVQKFNASRKFTTAVTSNNKAGAGGFYVYECKTCNRSFPSFQALGGHRASHkkpkaalaeapekkssasVPALAVLPTKNEYKDSYSTLHHHDQSHMQaasaaataannnntannnnKGGNKIHECSICGSEFTSGQALGGHMRRHRAAVATGNNINQVATIESNIGDVKPVAATRSILPLDLNLPAPEDDHHIRFGATQQSLVFSAPALVDCHY
********************************************************************************CLIMLA*************IIDDKVQKFNASRKFTTAVTSNNKAGAGGFYVYECKTCNRSFPSFQ********************************************************************************IHECSICGSEFTSGQALGGHMRRHRAAVATGNNINQVATIESNIGDVKPVAATRSILPLDLNLPAPEDDHHIRFGATQQSLVFSAPALVD***
*****************************************************************************MANCLIMLA**********************************************ECKTCNRSFPSF***********************************************************************************ECSICGSEFTSGQALGGH*************************************PLDLNLPAPEDDHHIRF********FSAPALVDCHY
****************************PFGFAV************DESYYSNNNNNNSVMSF************QDMANCLIMLAQGDDRSRQINQENIIDDKVQKFNASRKFTTAVTSNNKAGAGGFYVYECKTCNRSFPSFQA**************************VPALAVLPTKNEYKDSYST****************TAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRHRAAVATGNNINQVATIESNIGDVKPVAATRSILPLDLNLPAPEDDHHIRFGATQQSLVFSAPALVDCHY
MIMGSSSNDHQNNQIVKGKRTK*QRSTSPFG*****************************************EEDQDMANCLIMLAQ***************************************GGFYVYECKTCNRSFPSFQALGGH**************************************************************************KIHECSICGSEFTSGQALG************************************SILPLDLNLPAPEDDHHIRFGATQQSLVFSAPALVDCHY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIMGSSSNDHQNNQIVKGKRTKRQRSTSPFGFAVTDSSSSGNNSGADESYYSNNNNNNSVMSFPTTSGESTEEEDQDMANCLIMLAQGDDRSRQINQENIIDDKVQKFNASRKFTTAVTSNNKAGAGGFYVYECKTCNRSFPSFQALGGHRASHKKPKAALAEAPEKKSSASVPALAVLPTKNEYKDSYSTLHHHDQSHMQAASAAATAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRHRAAVATGNNINQVATIESNIGDVKPVAATRSILPLDLNLPAPEDDHHIRFGATQQSLVFSAPALVDCHY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
Q681X4286 Zinc finger protein ZAT5 yes no 0.845 0.940 0.429 2e-53
Q9SLD4178 Zinc finger protein ZAT11 no no 0.471 0.842 0.333 2e-21
Q9SHD0314 Zinc finger protein ZAT4 no no 0.506 0.512 0.299 1e-16
Q9M202288 Zinc finger protein ZAT9 no no 0.632 0.697 0.275 4e-14
Q9SSW2273 Zinc finger protein AZF2 no no 0.377 0.439 0.293 1e-12
Q42430261 Zinc finger protein 1 OS= N/A no 0.578 0.704 0.267 1e-12
Q9LX85164 Zinc finger protein ZAT8 no no 0.367 0.713 0.319 3e-12
Q39092267 Zinc finger protein ZAT1 no no 0.323 0.385 0.319 1e-10
Q42453168 Zinc finger protein ZAT7 no no 0.355 0.672 0.294 1e-10
Q9SSW1245 Zinc finger protein AZF1 no no 0.487 0.632 0.283 2e-10
>sp|Q681X4|ZAT5_ARATH Zinc finger protein ZAT5 OS=Arabidopsis thaliana GN=ZAT5 PE=2 SV=1 Back     alignment and function desciption
 Score =  209 bits (532), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 144/335 (42%), Positives = 179/335 (53%), Gaps = 66/335 (19%)

Query: 1   MIMGSSSNDHQNNQIVKGKRTKRQRSTSPFGFAVTDSSSSGNNSGADESY-YSNNNNNNS 59
           M+MG         QI+KGKRTKRQRS+S F      + +S ++S        + ++  NS
Sbjct: 1   MMMGQDEVGSDQTQIIKGKRTKRQRSSSTFVVTAATTVTSTSSSAGGSGGERAVSDEYNS 60

Query: 60  VMSFPTTSGESTEEEDQDMANCLIMLAQGDDRSRQINQENIIDDKVQKFNASRKFTTAVT 119
            +S P T+  + EEED  MA CLIMLA+G           ++         SRK    ++
Sbjct: 61  AVSSPVTTDCTQEEED--MAICLIMLARG----------TVLPSP--DLKNSRKIHQKIS 106

Query: 120 SNNKAGAGGFYVYECKTCNRSFPSFQALGGHRASHKKPKAALAE-----APEKKSSASVP 174
           S N +    FYVYECKTCNR+F SFQALGGHRASHKKP+ +  E       + KSSAS  
Sbjct: 107 SENSS----FYVYECKTCNRTFSSFQALGGHRASHKKPRTSTEEKTRLPLTQPKSSAS-- 160

Query: 175 ALAVLPTKNEYKDSYSTLHHHDQSHMQAASAAATAANNNNTANNNNKGGNKIHECSICGS 234
                                  SH +  S +A A+  +N  N      NK+HECSICGS
Sbjct: 161 ------------------EEGQNSHFKV-SGSALASQASNIINK----ANKVHECSICGS 197

Query: 235 EFTSGQALGGHMRRHRAAVATGNNINQVA---------TIESNIGDVKPVAATRSILPLD 285
           EFTSGQALGGHMRRHR AV T + +   A          IE NIG  + +   R  LPLD
Sbjct: 198 EFTSGQALGGHMRRHRTAVTTISPVAATAEVSRNSTEEEIEINIG--RSMEQQRKYLPLD 255

Query: 286 LNLPAPEDD-HHIRFGATQQSLVFSA-PALVDCHY 318
           LNLPAPEDD    +F    Q +VFSA PAL+DCHY
Sbjct: 256 LNLPAPEDDLRESKF----QGIVFSATPALIDCHY 286




Probable transcription factor that may be involved in stress responses.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SLD4|ZAT11_ARATH Zinc finger protein ZAT11 OS=Arabidopsis thaliana GN=ZAT11 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHD0|ZAT4_ARATH Zinc finger protein ZAT4 OS=Arabidopsis thaliana GN=ZAT4 PE=2 SV=1 Back     alignment and function description
>sp|Q9M202|ZAT9_ARATH Zinc finger protein ZAT9 OS=Arabidopsis thaliana GN=ZAT9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSW2|AZF2_ARATH Zinc finger protein AZF2 OS=Arabidopsis thaliana GN=AZF2 PE=2 SV=1 Back     alignment and function description
>sp|Q42430|ZFP1_WHEAT Zinc finger protein 1 OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q9LX85|ZAT8_ARATH Zinc finger protein ZAT8 OS=Arabidopsis thaliana GN=ZAT8 PE=2 SV=1 Back     alignment and function description
>sp|Q39092|ZAT1_ARATH Zinc finger protein ZAT1 OS=Arabidopsis thaliana GN=ZAT1 PE=2 SV=1 Back     alignment and function description
>sp|Q42453|ZAT7_ARATH Zinc finger protein ZAT7 OS=Arabidopsis thaliana GN=ZAT7 PE=2 SV=1 Back     alignment and function description
>sp|Q9SSW1|AZF1_ARATH Zinc finger protein AZF1 OS=Arabidopsis thaliana GN=AZF1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
118486693310 unknown [Populus trichocarpa] 0.864 0.887 0.512 2e-59
224104729313 predicted protein [Populus trichocarpa] 0.877 0.891 0.496 3e-59
224118336283 predicted protein [Populus trichocarpa] 0.786 0.883 0.490 4e-58
225436448296 PREDICTED: zinc finger protein ZAT5 [Vit 0.893 0.959 0.467 3e-57
255565477345 conserved hypothetical protein [Ricinus 0.905 0.834 0.484 1e-54
79564965286 C2H2-type zinc finger domain-containing 0.845 0.940 0.429 1e-51
297826123276 hypothetical protein ARALYDRAFT_481690 [ 0.855 0.985 0.434 3e-51
4803961284 putative zinc-finger protein [Arabidopsi 0.839 0.940 0.429 1e-50
225441153276 PREDICTED: zinc finger protein ZAT5 [Vit 0.827 0.952 0.416 1e-49
20546281 DNA-binding protein [Petunia x hybrida] 0.792 0.896 0.406 1e-49
>gi|118486693|gb|ABK95183.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  235 bits (600), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 196/324 (60%), Gaps = 49/324 (15%)

Query: 14  QIVKGKRTKRQRSTSPFGFAVTDSSSSGNNSGADESYYSNNNNNNSVMSFPTTSGESTEE 73
           QI+KGKRTKRQRS+SP+   +T SSSSG   G            +  +S PTTS E TE 
Sbjct: 17  QIIKGKRTKRQRSSSPY-MVMTSSSSSGYGGGDGGGERGVLIEEHGSISSPTTSSEVTER 75

Query: 74  EDQ--DMANCLIMLAQGDDRSRQINQENIIDDKVQKFNASRKFTTAVTSNNKAGAGGFYV 131
            ++  DMANCLI+LAQGD R +QI++      KV+KF A +    +  + NKAG   F V
Sbjct: 76  TEEEEDMANCLILLAQGD-RPKQIHENK--SGKVEKFRARKSSDMSTPTINKAG---FLV 129

Query: 132 YECKTCNRSFPSFQALGGHRASHKKPKAALAEAPEKKSSASVPALAV--LPTKNEYKDSY 189
           YECKTCNRSFPSFQALGGHRASHK+PKA  AE  +    AS+  L V  L  ++    S 
Sbjct: 130 YECKTCNRSFPSFQALGGHRASHKRPKAT-AEEKKGLVVASMEDLGVCQLIKRSNLDPSL 188

Query: 190 STLHHHDQSHMQAASAAATAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRH 249
           S    H+              NN N     NK   K HECSICGSEF SGQALGGHMRRH
Sbjct: 189 SLQIGHN--------------NNVNKGFQGNKA--KTHECSICGSEFMSGQALGGHMRRH 232

Query: 250 RAAVATGNNINQV------ATIESNI-GD---VKPVAATRSILPLDLNLPAPEDDHHIR- 298
           RA   TGN    +      AT ESNI GD   +KP    ++IL LDLNLPAPEDDHH+R 
Sbjct: 233 RA--NTGNQAGMITTDSSSATAESNIHGDHHQIKP----KNILALDLNLPAPEDDHHLRE 286

Query: 299 ----FGATQQSLVFSAPALVDCHY 318
               F +T+Q+LVFSA ALVDCHY
Sbjct: 287 SNFQFTSTRQALVFSATALVDCHY 310




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224104729|ref|XP_002313544.1| predicted protein [Populus trichocarpa] gi|222849952|gb|EEE87499.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118336|ref|XP_002331457.1| predicted protein [Populus trichocarpa] gi|222873535|gb|EEF10666.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225436448|ref|XP_002274374.1| PREDICTED: zinc finger protein ZAT5 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255565477|ref|XP_002523729.1| conserved hypothetical protein [Ricinus communis] gi|223537033|gb|EEF38669.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|79564965|ref|NP_180387.2| C2H2-type zinc finger domain-containing protein [Arabidopsis thaliana] gi|75322747|sp|Q681X4.1|ZAT5_ARATH RecName: Full=Zinc finger protein ZAT5 gi|51969128|dbj|BAD43256.1| putative zinc-finger protein [Arabidopsis thaliana] gi|110739467|dbj|BAF01643.1| putative zinc-finger protein [Arabidopsis thaliana] gi|330252996|gb|AEC08090.1| C2H2-type zinc finger domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297826123|ref|XP_002880944.1| hypothetical protein ARALYDRAFT_481690 [Arabidopsis lyrata subsp. lyrata] gi|297326783|gb|EFH57203.1| hypothetical protein ARALYDRAFT_481690 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|4803961|gb|AAD29833.1| putative zinc-finger protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225441153|ref|XP_002267645.1| PREDICTED: zinc finger protein ZAT5 [Vitis vinifera] gi|147788170|emb|CAN64839.1| hypothetical protein VITISV_030377 [Vitis vinifera] Back     alignment and taxonomy information
>gi|20546|emb|CAA43111.1| DNA-binding protein [Petunia x hybrida] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
TAIR|locus:2179924362 AT5G04390 "AT5G04390" [Arabido 0.254 0.223 0.535 4.7e-51
TAIR|locus:2046153286 AT2G28200 "AT2G28200" [Arabido 0.283 0.314 0.590 1.2e-39
TAIR|locus:2142674292 AT5G03510 "AT5G03510" [Arabido 0.308 0.335 0.439 8.1e-35
TAIR|locus:2075865398 AT3G10470 "AT3G10470" [Arabido 0.452 0.361 0.3 2.5e-25
TAIR|locus:2049811178 ZAT11 "AT2G37430" [Arabidopsis 0.245 0.438 0.412 1.6e-24
TAIR|locus:2054548156 AT2G28710 "AT2G28710" [Arabido 0.229 0.467 0.407 2.5e-19
TAIR|locus:2084046175 AT3G53600 "AT3G53600" [Arabido 0.229 0.417 0.389 2e-18
TAIR|locus:2055583314 AT2G45120 "AT2G45120" [Arabido 0.308 0.312 0.366 5.7e-17
TAIR|locus:2168073162 RHL41 "AT5G59820" [Arabidopsis 0.194 0.382 0.421 7.9e-17
TAIR|locus:2075291168 ZAT7 "AT3G46090" [Arabidopsis 0.207 0.392 0.388 3.4e-16
TAIR|locus:2179924 AT5G04390 "AT5G04390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 4.7e-51, Sum P(5) = 4.7e-51
 Identities = 45/84 (53%), Positives = 59/84 (70%)

Query:    72 EEEDQDMANCLIMLAQGDDRSRQINQ-ENIIDDKVQKFNASRKFTTAVTSNNKAGAGGFY 130
             +EEDQD+ANCLI+LAQG       +   N  ++   +F  SR+F    +S+N  G  G+Y
Sbjct:    94 DEEDQDIANCLILLAQGHSLPHNNHHLPNSNNNNTYRFT-SRRFLET-SSSNSGGKAGYY 151

Query:   131 VYECKTCNRSFPSFQALGGHRASH 154
             VY+CKTC+R+FPSFQALGGHRASH
Sbjct:   152 VYQCKTCDRTFPSFQALGGHRASH 175


GO:0003676 "nucleic acid binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
TAIR|locus:2046153 AT2G28200 "AT2G28200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142674 AT5G03510 "AT5G03510" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075865 AT3G10470 "AT3G10470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049811 ZAT11 "AT2G37430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054548 AT2G28710 "AT2G28710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084046 AT3G53600 "AT3G53600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055583 AT2G45120 "AT2G45120" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168073 RHL41 "AT5G59820" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075291 ZAT7 "AT3G46090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q681X4ZAT5_ARATHNo assigned EC number0.42980.84590.9405yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 4e-07
pfam1391227 pfam13912, zf-C2H2_6, C2H2-type zinc finger 5e-07
>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information
 Score = 45.3 bits (108), Expect = 4e-07
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 131 VYECKTCNRSFPSFQALGGHRASHKKP 157
           V+ C  C ++F S QALGGH+ SH   
Sbjct: 1   VHTCGVCGKTFSSLQALGGHKKSHCSL 27


Length = 27

>gnl|CDD|206083 pfam13912, zf-C2H2_6, C2H2-type zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.85
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 99.8
KOG1074 958 consensus Transcriptional repressor SALM [Transcri 99.68
KOG1074958 consensus Transcriptional repressor SALM [Transcri 99.53
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 99.49
KOG3576267 consensus Ovo and related transcription factors [T 99.43
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 99.23
KOG3576267 consensus Ovo and related transcription factors [T 99.18
KOG3608467 consensus Zn finger proteins [General function pre 99.06
KOG3608467 consensus Zn finger proteins [General function pre 99.01
PHA00733128 hypothetical protein 98.98
PHA0276855 hypothetical protein; Provisional 98.83
PHA0276855 hypothetical protein; Provisional 98.51
PLN03086567 PRLI-interacting factor K; Provisional 98.49
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.48
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.35
KOG3993500 consensus Transcription factor (contains Zn finger 98.25
PLN03086567 PRLI-interacting factor K; Provisional 98.24
PHA0061644 hypothetical protein 98.2
KOG3993500 consensus Transcription factor (contains Zn finger 98.2
PHA00733128 hypothetical protein 98.17
PHA0061644 hypothetical protein 98.07
PHA0073279 hypothetical protein 98.04
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.96
PHA0073279 hypothetical protein 97.86
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.77
COG5189423 SFP1 Putative transcriptional repressor regulating 97.69
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.63
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.63
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.38
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.31
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.2
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.06
smart0035526 ZnF_C2H2 zinc finger. 97.06
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.95
PRK04860160 hypothetical protein; Provisional 96.65
smart0035526 ZnF_C2H2 zinc finger. 96.59
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.57
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.56
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.95
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.91
COG5048467 FOG: Zn-finger [General function prediction only] 95.67
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.62
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.53
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.05
KOG1146 1406 consensus Homeobox protein [General function predi 94.85
PRK04860160 hypothetical protein; Provisional 94.49
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.52
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.36
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 91.39
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 91.35
COG5048467 FOG: Zn-finger [General function prediction only] 90.85
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.05
KOG2893 341 consensus Zn finger protein [General function pred 89.18
KOG11461406 consensus Homeobox protein [General function predi 86.78
COG5189423 SFP1 Putative transcriptional repressor regulating 86.77
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 86.52
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 82.97
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 82.17
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 82.01
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 81.36
KOG2893 341 consensus Zn finger protein [General function pred 80.83
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 80.32
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
Probab=99.85  E-value=3.5e-22  Score=175.71  Aligned_cols=118  Identities=20%  Similarity=0.301  Sum_probs=107.3

Q ss_pred             CCCceeecCCCCCcCCCccchhhhhhhcCC---CCCccCCCCCCCCCCCcchhhccCcccCCCCCchhhcccccccc---
Q 021063          127 GGFYVYECKTCNRSFPSFQALGGHRASHKK---PKAALAEAPEKKSSASVPALAVLPTKNEYKDSYSTLHHHDQSHM---  200 (318)
Q Consensus       127 ~g~~~y~C~~C~K~F~s~~~L~~H~rsHt~---~kp~~C~~C~k~f~~~~~~~~h~~~~~~~f~~~~~L~~H~~~h~---  200 (318)
                      .....|.|+.|||.+.+..+|.+|+.+|..   .+.+.|.+|+|.|...                 ..|+.|+|+|+   
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSm-----------------pALkMHirTH~l~c  188 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSM-----------------PALKMHIRTHTLPC  188 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeeh-----------------HHHhhHhhccCCCc
Confidence            455679999999999999999999999964   5779999999999766                 88899999987   


Q ss_pred             -ccchhhhhcCchhhhhhcccCCCCceeecCCCccccCChhHHHHHhhhccCCCCCCCCCcc
Q 021063          201 -QAASAAATAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRHRAAVATGNNINQ  261 (318)
Q Consensus       201 -~~~c~k~~~~~~~l~~h~~~htg~kpy~C~~Cgk~F~~~~~L~~H~r~H~~~~~~~~~~~~  261 (318)
                       |..|||.|+..+-|+.|++.|||||||.|..|+|+|+-+++|+.||++|.+.+.+.|..+.
T Consensus       189 ~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~  250 (279)
T KOG2462|consen  189 ECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCG  250 (279)
T ss_pred             ccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchh
Confidence             4559999999999999999999999999999999999999999999999999999987665



>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG1074 consensus Transcriptional repressor SALM [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG3576 consensus Ovo and related transcription factors [Transcription] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>KOG3608 consensus Zn finger proteins [General function prediction only] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription] Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>KOG2893 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 3e-10
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 4e-09
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 5e-04
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
 Score = 54.0 bits (130), Expect = 3e-10
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 131 VYECKTCNRSFPSFQALGGHRASHKKPKAAL 161
            Y C  C R F S QALGGH   H++ +A L
Sbjct: 6   SYTCSFCKREFRSAQALGGHMNVHRRDRARL 36


>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Length = 39 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.87
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.82
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.82
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.81
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.81
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.79
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.78
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.78
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.78
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.78
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.71
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.67
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.61
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.6
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.57
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.53
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.52
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.52
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.5
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.49
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.48
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.47
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.46
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.45
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.45
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.45
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.42
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.39
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.39
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.37
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.36
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.36
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.35
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.34
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.33
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.32
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.29
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.28
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.28
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.27
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.26
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.26
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.25
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.24
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.24
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.23
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.21
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.2
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.19
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.19
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.17
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.16
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.06
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.03
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.02
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.02
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.01
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.01
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.01
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.01
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.01
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.99
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 98.98
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 98.98
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.97
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.96
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.96
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.96
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.95
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.93
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.91
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.91
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.89
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.87
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.87
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.87
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.84
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.83
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.83
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.82
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.82
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 98.81
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.81
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.76
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.74
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.72
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.69
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.68
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.67
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.67
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.65
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.61
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.59
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.58
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.57
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.54
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.52
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.52
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.51
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.51
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.51
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.49
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.47
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.47
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.47
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.47
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.45
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.44
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.43
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.42
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.42
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.42
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.41
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.78
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.78
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.4
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.39
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.37
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.32
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.64
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.29
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.29
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.28
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.25
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.23
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.53
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.22
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.53
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.2
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.19
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.18
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.18
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.17
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.16
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.14
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.14
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.14
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.13
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.27
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.78
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.9
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.49
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.01
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.58
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.19
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.57
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.88
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 86.29
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 84.07
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 83.74
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 83.43
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.87  E-value=1.5e-23  Score=179.36  Aligned_cols=129  Identities=22%  Similarity=0.346  Sum_probs=71.7

Q ss_pred             CCCCceeecCCCCCcCCCccchhhhhhhcCCCCCccCCCCCCCCCCCcchhhcc-----------CcccCCCCCchhhcc
Q 021063          126 AGGFYVYECKTCNRSFPSFQALGGHRASHKKPKAALAEAPEKKSSASVPALAVL-----------PTKNEYKDSYSTLHH  194 (318)
Q Consensus       126 h~g~~~y~C~~C~K~F~s~~~L~~H~rsHt~~kp~~C~~C~k~f~~~~~~~~h~-----------~~~~~~f~~~~~L~~  194 (318)
                      |.++++|.|..|++.|.....|..|+++|.++++|.|..|++.|.....|..|+           ..|+..|.....|..
T Consensus        44 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  123 (190)
T 2i13_A           44 HTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRA  123 (190)
T ss_dssp             C---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHH
T ss_pred             cCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHH
Confidence            345556666666666666666666666666666666666666666655554443           224445555555666


Q ss_pred             ccccccccc------hhhhhcCchhhhhhcccCCCCceeecCCCccccCChhHHHHHhhhccCCCC
Q 021063          195 HDQSHMQAA------SAAATAANNNNTANNNNKGGNKIHECSICGSEFTSGQALGGHMRRHRAAVA  254 (318)
Q Consensus       195 H~~~h~~~~------c~k~~~~~~~l~~h~~~htg~kpy~C~~Cgk~F~~~~~L~~H~r~H~~~~~  254 (318)
                      |+++|.+++      |++.|.....|..|++.|++++||+|.+|++.|.+...|..|+++|+|++|
T Consensus       124 H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~  189 (190)
T 2i13_A          124 HQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKT  189 (190)
T ss_dssp             HHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC-----
T ss_pred             HHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCC
Confidence            655554332      556666666666666655566666666666666666666666666655544



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 2e-13
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 4e-12
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Plant C2H2 finger (QALGGH zinc finger)
domain: SUPERMAN zinc finger domain
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 61.7 bits (150), Expect = 2e-13
 Identities = 15/31 (48%), Positives = 18/31 (58%)

Query: 131 VYECKTCNRSFPSFQALGGHRASHKKPKAAL 161
            Y C  C R F S QALGGH   H++ +A L
Sbjct: 5   SYTCSFCKREFRSAQALGGHMNVHRRDRARL 35


>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.55
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.54
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.37
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.35
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.26
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.24
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.21
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.2
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.18
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.12
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.11
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.09
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.08
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.01
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.01
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.0
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.96
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.92
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.91
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.91
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.91
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.88
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.82
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.81
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.79
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.78
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.68
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.68
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.68
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.67
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.66
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.62
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.6
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.6
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.55
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.52
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.49
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.4
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.32
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.0
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.98
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.9
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.84
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.8
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.8
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.75
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.72
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.65
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.56
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.48
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.43
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.38
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.37
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.29
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.27
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.21
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.21
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.08
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.07
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.05
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.96
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.83
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.76
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.73
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.71
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.68
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.64
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.64
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.53
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.5
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.48
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.31
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.72
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.7
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.65
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.51
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.19
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.13
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.03
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.35
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.3
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.29
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.86
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.49
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.11
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.87
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 92.52
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.17
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.14
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 91.44
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.34
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 89.55
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.21
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.42
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.73
d1y0jb136 U-shaped transcription factor, different fingers { 86.69
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 86.67
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 84.63
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 83.49
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 83.02
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.89
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 82.29
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.55  E-value=4.4e-16  Score=104.07  Aligned_cols=53  Identities=28%  Similarity=0.409  Sum_probs=48.3

Q ss_pred             CCCccCCCCCCCCCCCcchhhccCcccCCCCCchhhccccccccccchhhhhcCchhhhhhcccCCCCceeecCCCcccc
Q 021063          157 PKAALAEAPEKKSSASVPALAVLPTKNEYKDSYSTLHHHDQSHMQAASAAATAANNNNTANNNNKGGNKIHECSICGSEF  236 (318)
Q Consensus       157 ~kp~~C~~C~k~f~~~~~~~~h~~~~~~~f~~~~~L~~H~~~h~~~~c~k~~~~~~~l~~h~~~htg~kpy~C~~Cgk~F  236 (318)
                      ||||.|+ |++.|...                 ..|..|+++|                      +|+|||+|.+||+.|
T Consensus         1 EK~y~C~-Cgk~F~~~-----------------~~l~~H~~~H----------------------t~ekpy~C~~C~k~F   40 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHK-----------------SQRDRHMSMH----------------------LGLRPYGCGVCGKKF   40 (53)
T ss_dssp             CCCEECT-TSCEESSH-----------------HHHHHHHHHH----------------------SCCCSEECTTTSCEE
T ss_pred             CcCCCCC-CCCeECCH-----------------HHhHHHhhcc----------------------ccccCCcCCCcCCEe
Confidence            6899995 99999777                 8888888877                      799999999999999


Q ss_pred             CChhHHHHHhhhc
Q 021063          237 TSGQALGGHMRRH  249 (318)
Q Consensus       237 ~~~~~L~~H~r~H  249 (318)
                      .+...|..||++|
T Consensus        41 ~~~~~L~~H~r~H   53 (53)
T d2csha1          41 KMKHHLVGHMKIH   53 (53)
T ss_dssp             SSSHHHHHHHTTT
T ss_pred             cCHHHHHHHHhcC
Confidence            9999999999998



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure