Citrus Sinensis ID: 021128


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDRFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKVSMNMCFGTSFAMTKKRIEVLKFS
ccccHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEHHHHHcccEEEEEEECcCCccccccccccccccCEEEEEcccCEEEEEccccccccccCEEEEEEEEEEEcccccccccEEEEccccccccccccccEEEEEEEccccccEEccccEEEEEEccHHHHccccEEEEEccccccEEEEEccccccccccEEEEccccccccccc
****RARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGNEEANKRFAEINNAYEVLSDSETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPM*******KGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYED*****DGEPGDLKFRIRTAPHDRFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKVSMNMCFGTSFAMTKK*IE*****
xxxxxxxxxxxxxxxHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHRRARLLFLLCALCYALNVIAGKSYYEVLQVPRGASDEQIKRAYRKLALKYHPDKNQGxxxxxxxxxxxxxxxxxxxxxETRNIYDTYGEEGLKQHAAGGGRGGGMGVNIQDIFSSFFGGGPMEEDEKIVKGDDVIVELDATLEDLYMGGSLKVWREKNVIKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCDQCQNVKYEREGYFVTVDIEKGMQDGQEVVFYEDGEPKIDGEPGDLKFRIRTAPHDRFRREGNNLHTTVTVTLVQALVGFEKTIEHLDEHLVDISTKVSMNMCFGTSFAMTKKRIEVLKFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DnaJ homolog subfamily B member 11 Serves as a co-chaperone for HSPA5. Binds directly to both unfolded proteins that are substrates for ERAD and nascent unfolded peptide chains, but dissociates from the HSPA5-unfolded protein complex before folding is completed. May help recruiting HSPA5 and other chaperones to the substrate. Stimulates HSPA5 ATPase activity.probableQ99KV1
DnaJ homolog subfamily B member 11 Serves as a co-chaperone for HSPA5. Binds directly to both unfolded proteins that are substrates for ERAD and nascent unfolded peptide chains, but dissociates from the HSPA5-unfolded protein complex before folding is completed. May help recruiting HSPA5 and other chaperones to the substrate. Stimulates HSPA5 ATPase activity.probableQ6TUG0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LZ8, chain A
Confidence level:very confident
Coverage over the Query: 136-176,203-314
View the alignment between query and template
View the model in PyMOL
Template: 1NLT, chain A
Confidence level:very confident
Coverage over the Query: 131-314
View the alignment between query and template
View the model in PyMOL