Citrus Sinensis ID: 021154


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGLQFIPMDQIIKDSVESLKAKGFIS
ccccccEEEEcccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHcccccccEEEEEccccccccHHHHHccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHccccccccccccccEEHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHccccEEEcHHHHHHHHHHHHHHccccc
ccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccccHHEEEEEHcHcccccHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHEEEEccccccccccEcccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEcccEEEcccccccccHHHHHHHHHHcccHHHHHHHHEcEEEHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHcccccccccccccccccccEEEcHHHHHHcccEEccHHHHHHHHHHHHHHccccc
MSKEAEVVCVtggsgcigSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTgvfhlaspcivdkvedpqnqllnpavkgTVNVLTAAKALGVKRVVVTSSissitpspkwpadkvkdedcwtdeeyCRQNETLAEKAAWEFAKekgldvvvvnpgtvmgpvipptLNASMLMLLRLLQGCTdtyenffmgsvhfKDVALAHILVyenpsacgrHLCVEAISHYGDFVAKVAelypeydiprlpkdtqpgllrtkDGAKKLMDLglqfipmdQIIKDSVESLKAKGFIS
MSKEAEVVcvtggsgcigSWLVSLLLERRYTVHATvknlsdereTAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRVVVTssissitpspkwpadkvKDEDCWTDEEYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEydiprlpkdtqpglLRTKDGAKKLMDLGLQFIPMDQIIKDSVESLKAKGFIS
MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQidlldydaiaaaVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRvvvtssissitpspKWPADKVKDEDCWTDEEYCRQNETLaekaawefakekGLDVVVVNPGTVMGPVIPPTLNASmlmllrllQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGLQFIPMDQIIKDSVESLKAKGFIS
******VVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRVVVTSSISSITP**KWPADKVKDEDCWTDEEYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLP******LLRTKDGAKKLMDLGLQFIPMDQIIK*************
****AEV**VTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGLQFIPMDQIIKDSVESLKAKGFIS
*********VTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGLQFIPMDQIIKDSVESLKAKGFIS
****AEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGLQFIPMDQIIKDSVESLKAK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVKRVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGLQFIPMDQIIKDSVESLKAKGFIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
Q9S9N9344 Cinnamoyl-CoA reductase 1 no no 0.977 0.898 0.458 1e-67
Q9SAH9332 Cinnamoyl-CoA reductase 2 no no 0.977 0.930 0.433 5e-64
P51110337 Dihydroflavonol-4-reducta no no 0.984 0.922 0.373 5e-55
Q500U8326 Tetraketide alpha-pyrone no no 0.968 0.938 0.377 3e-54
Q9XES5348 Bifunctional dihydroflavo N/A no 0.987 0.896 0.362 2e-53
Q84KP0347 Bifunctional dihydroflavo N/A no 0.987 0.899 0.359 7e-53
P51104360 Dihydroflavonol-4-reducta N/A no 0.977 0.858 0.354 2e-52
Q9CA28321 Tetraketide alpha-pyrone no no 0.955 0.940 0.362 6e-52
P51102382 Dihydroflavonol-4-reducta no no 0.987 0.816 0.353 1e-48
P14720380 Dihydroflavonol-4-reducta N/A no 0.965 0.802 0.358 7e-47
>sp|Q9S9N9|CCR1_ARATH Cinnamoyl-CoA reductase 1 OS=Arabidopsis thaliana GN=CCR1 PE=1 SV=1 Back     alignment and function desciption
 Score =  256 bits (655), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 148/323 (45%), Positives = 202/323 (62%), Gaps = 14/323 (4%)

Query: 2   SKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLF 61
           S   + VCVTG  G I SW+V +LLER YTV  TV+N  D + T HL+ LEG   RL L 
Sbjct: 7   SPAGKTVCVTGAGGYIASWIVKILLERGYTVKGTVRNPDDPKNT-HLRELEGGKERLILC 65

Query: 62  QIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGVK 121
           + DL DY+A+ AA+ GC GVFH ASP      +DP+ Q++ PAV G   V+ AA    VK
Sbjct: 66  KADLQDYEALKAAIDGCDGVFHTASPV----TDDPE-QMVEPAVNGAKFVINAAAEAKVK 120

Query: 122 RVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNET-------LAEKAAWEFAKEKG 174
           RVV+TSSI ++   P    + V DE CW+D ++C+  +        +AE+AAWE AKEKG
Sbjct: 121 RVVITSSIGAVYMDPNRDPEAVVDESCWSDLDFCKNTKNWYCYGKMVAEQAAWETAKEKG 180

Query: 175 LDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYE 234
           +D+VV+NP  V+GP + PT+NAS+  +L+ L G   TY N     V  +DVALAH+LVYE
Sbjct: 181 VDLVVLNPVLVLGPPLQPTINASLYHVLKYLTGSAKTYANLTQAYVDVRDVALAHVLVYE 240

Query: 235 NPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQ-PGLLRTKDGAKKLMDLGL 293
            PSA GR+L  E+  H G+ V  +A+L+PEY +P   KD + P     K   +K+ DLGL
Sbjct: 241 APSASGRYLLAESARHRGEVVEILAKLFPEYPLPTKCKDEKNPRAKPYKFTNQKIKDLGL 300

Query: 294 QFIPMDQIIKDSVESLKAKGFIS 316
           +F    Q + D+V+SL+ KG ++
Sbjct: 301 EFTSTKQSLYDTVKSLQEKGHLA 323




Involved in the latter stages of lignin biosynthesis. Catalyzes one of the last steps of monolignol biosynthesis, the conversion of cinnamoyl-CoAs into their corresponding cinnamaldehydes.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 4EC: 4
>sp|Q9SAH9|CCR2_ARATH Cinnamoyl-CoA reductase 2 OS=Arabidopsis thaliana GN=CCR2 PE=1 SV=1 Back     alignment and function description
>sp|P51110|DFRA_VITVI Dihydroflavonol-4-reductase OS=Vitis vinifera GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q500U8|TKPR1_ARATH Tetraketide alpha-pyrone reductase 1 OS=Arabidopsis thaliana GN=TKPR1 PE=2 SV=1 Back     alignment and function description
>sp|Q9XES5|DFRA_MALDO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Malus domestica GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|Q84KP0|DFRA_PYRCO Bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase OS=Pyrus communis GN=DFR PE=1 SV=1 Back     alignment and function description
>sp|P51104|DFRA_DIACA Dihydroflavonol-4-reductase OS=Dianthus caryophyllus GN=A PE=2 SV=1 Back     alignment and function description
>sp|Q9CA28|TKPR2_ARATH Tetraketide alpha-pyrone reductase 2 OS=Arabidopsis thaliana GN=TKPR2 PE=2 SV=1 Back     alignment and function description
>sp|P51102|DFRA_ARATH Dihydroflavonol-4-reductase OS=Arabidopsis thaliana GN=DFRA PE=3 SV=2 Back     alignment and function description
>sp|P14720|DFRA_PETHY Dihydroflavonol-4-reductase OS=Petunia hybrida GN=DFRA PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
255571350323 cinnamoyl-CoA reductase, putative [Ricin 0.996 0.975 0.810 1e-155
228480464329 cinnamoyl-CoA reductase [Camellia oleife 0.990 0.951 0.803 1e-152
225434488329 PREDICTED: dihydroflavonol-4-reductase [ 0.990 0.951 0.809 1e-151
297793385323 cinnamoyl-CoA reductase family [Arabidop 1.0 0.978 0.783 1e-150
224103873323 predicted protein [Populus trichocarpa] 1.0 0.978 0.820 1e-150
15237678324 Rossmann-fold NAD(P)-binding domain-cont 1.0 0.975 0.764 1e-147
357491057320 Dihydroflavonol 4-reductase-like protein 0.987 0.975 0.774 1e-146
356500898320 PREDICTED: dihydroflavonol-4-reductase-l 0.984 0.971 0.770 1e-145
356553106320 PREDICTED: dihydroflavonol-4-reductase-l 0.984 0.971 0.761 1e-144
47900734324 NmrA-like family protein [Solanum demiss 0.990 0.966 0.775 1e-142
>gi|255571350|ref|XP_002526624.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223534064|gb|EEF35783.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 261/322 (81%), Positives = 293/322 (90%), Gaps = 7/322 (2%)

Query: 1   MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRL 60
           MSKE E VCVTGGSGCIGSWLV LLL+R YTVHATVKNL+DE+ET HL++LEGA++RLRL
Sbjct: 1   MSKEGETVCVTGGSGCIGSWLVHLLLQRGYTVHATVKNLNDEKETKHLESLEGAESRLRL 60

Query: 61  FQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGV 120
           +QIDLL YD+I AAV GC GVFHLASPCIVD+V+DPQ QLL+PA+KGT+NVLTAAK  GV
Sbjct: 61  YQIDLLHYDSIVAAVAGCAGVFHLASPCIVDRVQDPQGQLLDPAIKGTLNVLTAAKEKGV 120

Query: 121 KRVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQN-------ETLAEKAAWEFAKEK 173
           KRVVVTSSIS+ITP+P WPAD +K EDCWTD +YC QN       +TLAEK AWEFAKEK
Sbjct: 121 KRVVVTSSISAITPNPNWPADVIKSEDCWTDVDYCNQNGLWYPLSKTLAEKVAWEFAKEK 180

Query: 174 GLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVY 233
           GLDVVVVNPGTVMGPVIPPT+NASMLML+RLLQGCT+TY++FFMGSVHFKDVA+AHI+VY
Sbjct: 181 GLDVVVVNPGTVMGPVIPPTINASMLMLVRLLQGCTETYQDFFMGSVHFKDVAMAHIMVY 240

Query: 234 ENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGL 293
           ENPSA GRHLCVEAISHYGDFVAKVAELYPEY +PRLPKDTQPGLLR KDGAKKLM+LGL
Sbjct: 241 ENPSASGRHLCVEAISHYGDFVAKVAELYPEYKVPRLPKDTQPGLLRAKDGAKKLMELGL 300

Query: 294 QFIPMDQIIKDSVESLKAKGFI 315
           +FIPM+QIIKD+VESLK+KG I
Sbjct: 301 EFIPMEQIIKDAVESLKSKGLI 322




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|228480464|gb|ACQ41893.1| cinnamoyl-CoA reductase [Camellia oleifera] Back     alignment and taxonomy information
>gi|225434488|ref|XP_002275195.1| PREDICTED: dihydroflavonol-4-reductase [Vitis vinifera] gi|297745846|emb|CBI15902.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297793385|ref|XP_002864577.1| cinnamoyl-CoA reductase family [Arabidopsis lyrata subsp. lyrata] gi|297310412|gb|EFH40836.1| cinnamoyl-CoA reductase family [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224103873|ref|XP_002313227.1| predicted protein [Populus trichocarpa] gi|222849635|gb|EEE87182.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15237678|ref|NP_200657.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] gi|10177026|dbj|BAB10264.1| dihydroflavonol 4-reductase-like [Arabidopsis thaliana] gi|21592589|gb|AAM64538.1| cinnamoyl-CoA reductase-like protein [Arabidopsis thaliana] gi|27754235|gb|AAO22571.1| putative cinnamoyl-CoA reductase [Arabidopsis thaliana] gi|332009676|gb|AED97059.1| Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357491057|ref|XP_003615816.1| Dihydroflavonol 4-reductase-like protein [Medicago truncatula] gi|355517151|gb|AES98774.1| Dihydroflavonol 4-reductase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356500898|ref|XP_003519267.1| PREDICTED: dihydroflavonol-4-reductase-like [Glycine max] Back     alignment and taxonomy information
>gi|356553106|ref|XP_003544899.1| PREDICTED: dihydroflavonol-4-reductase-like [Glycine max] Back     alignment and taxonomy information
>gi|47900734|gb|AAT39306.1| NmrA-like family protein [Solanum demissum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2171258324 AT5G58490 [Arabidopsis thalian 1.0 0.975 0.647 2.3e-110
TAIR|locus:2056171318 AT2G02400 [Arabidopsis thalian 0.971 0.965 0.386 8.8e-63
TAIR|locus:2033904325 AT1G51410 [Arabidopsis thalian 0.984 0.956 0.401 4.2e-56
TAIR|locus:2150315326 AT5G19440 [Arabidopsis thalian 0.984 0.953 0.406 2.1e-54
TAIR|locus:2200427344 CCR1 "cinnamoyl coa reductase 0.977 0.898 0.380 6.5e-51
TAIR|locus:2025832332 CCR2 "cinnamoyl coa reductase" 0.977 0.930 0.362 1.8e-48
TAIR|locus:2033394319 AT1G66800 [Arabidopsis thalian 0.965 0.956 0.388 3.7e-48
TAIR|locus:2012250369 AT1G09480 [Arabidopsis thalian 0.981 0.840 0.358 3.8e-46
TAIR|locus:2012315322 AT1G09510 [Arabidopsis thalian 0.977 0.959 0.363 3.8e-46
TAIR|locus:2012265322 AT1G09490 [Arabidopsis thalian 0.977 0.959 0.347 1.5e-44
TAIR|locus:2171258 AT5G58490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1090 (388.8 bits), Expect = 2.3e-110, P = 2.3e-110
 Identities = 209/323 (64%), Positives = 243/323 (75%)

Query:     1 MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRL 60
             ++ E EVVCVTG SGCIGSWLV  LL R Y+VHATVKNL DE+ET HL+ LEGA TRL L
Sbjct:     2 LTDEREVVCVTGASGCIGSWLVHQLLLRGYSVHATVKNLQDEKETKHLEGLEGAATRLHL 61

Query:    61 FQXXXXXXXXXXXXVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGV 120
             F+            + GC+GVFHLASPCIVD+V+DPQ QLL+PAVKGT+NVLTAAK   V
Sbjct:    62 FEMDLLQYDTVSAAINGCSGVFHLASPCIVDEVQDPQKQLLDPAVKGTINVLTAAKEASV 121

Query:   121 KRXXXXXXXXXXXXXXKWPADKVKDEDCWTDEEYCRQN-------ETLXXXXXXXXXXXX 173
             KR               WPADK+K+E+CW  E+YCRQN       +TL            
Sbjct:   122 KRVVVTSSISAITPSPNWPADKIKNEECWAAEDYCRQNGLWYPLSKTLAEKAAWEFAEEK 181

Query:   174 GLDVVVVNPGTVMGPVIPPTLNASXXXXXXXXQGCTDTYENFFMGSVHFKDVALAHILVY 233
             GLDVVVVNPGTVMGPVIPP+LNAS        QGCT+TYENFFMGSVHFKDVALAHILVY
Sbjct:   182 GLDVVVVNPGTVMGPVIPPSLNASMHMLLRLLQGCTETYENFFMGSVHFKDVALAHILVY 241

Query:   234 ENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGL 293
             E+P + GRHLCVEAISHYGDFVAKVAELYP Y++P+LP++TQPGLLR K+ +KKL+DLGL
Sbjct:   242 EDPYSKGRHLCVEAISHYGDFVAKVAELYPNYNVPKLPRETQPGLLRDKNASKKLIDLGL 301

Query:   294 QFIPMDQIIKDSVESLKAKGFIS 316
             +FI M++IIK+ VESLK+KGFIS
Sbjct:   302 KFISMEEIIKEGVESLKSKGFIS 324




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0009809 "lignin biosynthetic process" evidence=ISS
GO:0016621 "cinnamoyl-CoA reductase activity" evidence=ISS
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
TAIR|locus:2056171 AT2G02400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033904 AT1G51410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150315 AT5G19440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200427 CCR1 "cinnamoyl coa reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025832 CCR2 "cinnamoyl coa reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033394 AT1G66800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012250 AT1G09480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012315 AT1G09510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012265 AT1G09490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024039001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (329 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
cd08958293 cd08958, FR_SDR_e, flavonoid reductase (FR), exten 1e-148
PLN02662322 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase 1e-114
PLN02214342 PLN02214, PLN02214, cinnamoyl-CoA reductase 3e-88
PLN02986322 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase 2e-79
PLN02650351 PLN02650, PLN02650, dihydroflavonol-4-reductase 2e-77
PLN02989325 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase 2e-70
cd05227301 cd05227, AR_SDR_e, aldehyde reductase, extended (e 2e-69
cd05193295 cd05193, AR_like_SDR_e, aldehyde reductase, flavon 1e-61
PLN00198338 PLN00198, PLN00198, anthocyanidin reductase; Provi 3e-56
PLN02896353 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase 4e-56
PLN02583297 PLN02583, PLN02583, cinnamoyl-CoA reductase 2e-47
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 1e-41
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 2e-36
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 9e-33
PLN02686367 PLN02686, PLN02686, cinnamoyl-CoA reductase 3e-28
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 2e-22
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 4e-19
cd05257316 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, 2e-18
cd08946200 cd08946, SDR_e, extended (e) SDRs 4e-18
cd05234305 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, 1e-17
cd05241331 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid d 5e-16
cd05232303 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, 2e-13
TIGR04180297 TIGR04180, EDH_00030, NAD dependent epimerase/dehy 2e-13
pfam13460182 pfam13460, NAD_binding_10, NADH(P)-binding 3e-13
cd05240306 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase 8e-13
cd09811354 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD 1e-12
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydr 1e-12
cd05243203 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 4e-12
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 4e-12
cd05251242 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional 2e-11
cd05226176 cd05226, SDR_e_a, Extended (e) and atypical (a) SD 1e-10
cd09813335 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD 2e-10
cd05269272 cd05269, TMR_SDR_a, triphenylmethane reductase (TM 2e-10
cd05263293 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens 2e-10
cd05260316 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase 3e-10
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 3e-10
cd05231259 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcript 2e-09
cd05258337 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, e 4e-09
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 4e-09
COG3320382 COG3320, COG3320, Putative dehydrogenase domain of 6e-09
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 1e-08
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 2e-08
smart00822180 smart00822, PKS_KR, This enzymatic domain is part 3e-08
TIGR03589324 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehyd 3e-08
pfam08659181 pfam08659, KR, KR domain 4e-08
TIGR02622349 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydra 5e-08
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynt 8e-08
cd05252336 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata 1e-07
cd05230305 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase 3e-07
cd05264300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 3e-07
cd05244207 cd05244, BVR-B_like_SDR_a, biliverdin IX beta redu 3e-07
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 5e-07
COG1028251 COG1028, FabG, Dehydrogenases with different speci 7e-07
PRK07201 657 PRK07201, PRK07201, short chain dehydrogenase; Pro 7e-07
COG0702275 COG0702, COG0702, Predicted nucleoside-diphosphate 1e-06
PLN02240352 PLN02240, PLN02240, UDP-glucose 4-epimerase 1e-06
cd05254280 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4 1e-06
cd05245293 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 2e-06
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-06
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 2e-06
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate 3e-06
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 5e-06
TIGR04130337 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehyd 5e-06
cd08957307 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptic 5e-06
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 6e-06
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 7e-06
cd09812339 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid 7e-06
cd05271273 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ub 1e-05
cd05229302 cd05229, SDR_a3, atypical (a) SDRs, subgroup 3 2e-05
cd05262291 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 2e-05
pfam05368232 pfam05368, NmrA, NmrA-like family 3e-05
cd05273328 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP- 4e-05
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell enve 4e-05
cd05237287 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-l 5e-05
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-05
cd05239300 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, exte 9e-05
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 1e-04
PLN00141251 PLN00141, PLN00141, Tic62-NAD(P)-related group II 2e-04
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 3e-04
cd05253332 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimera 3e-04
PRK05865 854 PRK05865, PRK05865, hypothetical protein; Provisio 4e-04
cd05272308 cd05272, TDH_SDR_e, L-threonine dehydrogenase, ext 5e-04
cd05238305 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a n 7e-04
cd05242296 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8 0.001
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 0.001
cd05274375 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatt 0.001
TIGR01777291 TIGR01777, yfcH, TIGR01777 family protein 0.001
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.001
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 0.001
cd08947224 cd08947, NmrA_TMR_like_SDR_a, NmrA (a transcriptio 0.002
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 0.002
cd08955376 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase ( 0.002
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 0.003
cd05235290 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 0.004
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 0.004
PRK10675338 PRK10675, PRK10675, UDP-galactose-4-epimerase; Pro 0.004
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 0.004
>gnl|CDD|187661 cd08958, FR_SDR_e, flavonoid reductase (FR), extended (e) SDRs Back     alignment and domain information
 Score =  417 bits (1075), Expect = e-148
 Identities = 153/294 (52%), Positives = 203/294 (69%), Gaps = 9/294 (3%)

Query: 8   VCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLD 67
           VCVTG SG IGSWLV  LL+R YTV ATV++  DE++ AHL  LEGA  RL+LF+ DLLD
Sbjct: 1   VCVTGASGFIGSWLVKRLLQRGYTVRATVRDPGDEKKVAHLLELEGAKERLKLFKADLLD 60

Query: 68  YDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTA-AKALGVKRVVVT 126
           Y +  AA+ GC GVFH+ASP   D  EDP+ +++ PAVKGT+NVL A AKA  VKRVV T
Sbjct: 61  YGSFDAAIDGCDGVFHVASPVDFD-SEDPEEEMIEPAVKGTLNVLEACAKAKSVKRVVFT 119

Query: 127 SSISSITPSPKWPADKVKDEDCWTDEEYCRQNE-------TLAEKAAWEFAKEKGLDVVV 179
           SS++++  +P     KV DE CW+D ++C++ +       TLAEKAAWEFA+E GLD+V 
Sbjct: 120 SSVAAVVWNPNRGEGKVVDESCWSDLDFCKKTKLWYALSKTLAEKAAWEFAEENGLDLVT 179

Query: 180 VNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYENPSAC 239
           VNP  V+GP + P+LN+S  ++L LL+G  + Y+N  +  VH  DVA AHIL+YE PSA 
Sbjct: 180 VNPSLVVGPFLQPSLNSSSQLILSLLKGNAEMYQNGSLALVHVDDVADAHILLYEKPSAS 239

Query: 240 GRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGL 293
           GR++C   +    +  A +A+ YP+Y+IP   +D QPG+ R K  +KKL DLG 
Sbjct: 240 GRYICSSHVVTRPELAALLAKKYPQYNIPTKFEDDQPGVARVKLSSKKLKDLGF 293


This subgroup contains FRs of the extended SDR-type and related proteins. These FRs act in the NADP-dependent reduction of flavonoids, ketone-containing plant secondary metabolites; they have the characteristic active site triad of the SDRs (though not the upstream active site Asn) and a NADP-binding motif that is very similar to the typical extended SDR motif. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 293

>gnl|CDD|178268 PLN02662, PLN02662, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|177862 PLN02214, PLN02214, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|178567 PLN02986, PLN02986, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|178256 PLN02650, PLN02650, dihydroflavonol-4-reductase Back     alignment and domain information
>gnl|CDD|178569 PLN02989, PLN02989, cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|187538 cd05227, AR_SDR_e, aldehyde reductase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187536 cd05193, AR_like_SDR_e, aldehyde reductase, flavonoid reductase, and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215100 PLN00198, PLN00198, anthocyanidin reductase; Provisional Back     alignment and domain information
>gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|178195 PLN02583, PLN02583, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|215370 PLN02686, PLN02686, cinnamoyl-CoA reductase Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187567 cd05257, Arna_like_SDR_e, Arna decarboxylase_like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|212494 cd08946, SDR_e, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187545 cd05234, UDP_G4E_2_SDR_e, UDP-glucose 4 epimerase, subgroup 2, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187552 cd05241, 3b-HSD-like_SDR_e, 3beta-hydroxysteroid dehydrogenases (3b-HSD)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187543 cd05232, UDP_G4E_4_SDR_e, UDP-glucose 4 epimerase, subgroup 4, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|200431 TIGR04180, EDH_00030, NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family Back     alignment and domain information
>gnl|CDD|222146 pfam13460, NAD_binding_10, NADH(P)-binding Back     alignment and domain information
>gnl|CDD|187551 cd05240, UDP_G4E_3_SDR_e, UDP-glucose 4 epimerase (G4E), subgroup 3, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187671 cd09811, 3b-HSD_HSDB1_like_SDR_e, human 3beta-HSD (hydroxysteroid dehydrogenase) and HSD3B1(delta 5-delta 4-isomerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|216283 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|187554 cd05243, SDR_a5, atypical (a) SDRs, subgroup 5 Back     alignment and domain information
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187561 cd05251, NmrA_like_SDR_a, NmrA (a transcriptional regulator) and HSCARG (an NADPH sensor) like proteins, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187537 cd05226, SDR_e_a, Extended (e) and atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187673 cd09813, 3b-HSD-NSDHL-like_SDR_e, human NSDHL (NAD(P)H steroid dehydrogenase-like protein)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187578 cd05269, TMR_SDR_a, triphenylmethane reductase (TMR)-like proteins, NMRa-like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187573 cd05263, MupV_like_SDR_e, Pseudomonas fluorescens MupV-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187542 cd05231, NmrA_TMR_like_1_SDR_a, NmrA (a transcriptional regulator) and triphenylmethane reductase (TMR) like proteins, subgroup 1, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|225857 COG3320, COG3320, Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases Back     alignment and domain information
>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|219957 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|233954 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|217199 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187541 cd05230, UGD_SDR_e, UDP-glucuronate decarboxylase (UGD) and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187555 cd05244, BVR-B_like_SDR_a, biliverdin IX beta reductase (BVR-B, aka flavin reductase)-like proteins; atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223774 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase Back     alignment and domain information
>gnl|CDD|187564 cd05254, dTDP_HR_like_SDR_e, dTDP-6-deoxy-L-lyxo-4-hexulose reductase and related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187556 cd05245, SDR_a2, atypical (a) SDRs, subgroup 2 Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|224011 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|200381 TIGR04130, FnlA, UDP-N-acetylglucosamine 4,6-dehydratase/5-epimerase Back     alignment and domain information
>gnl|CDD|187660 cd08957, WbmH_like_SDR_e, Bordetella bronchiseptica enzymes WbmH and WbmG-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|219687 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|187672 cd09812, 3b-HSD_like_1_SDR_e, 3beta-hydroxysteroid dehydrogenase (3b-HSD)-like, subgroup1, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187579 cd05271, NDUFA9_like_SDR_a, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, subunit 9, 39 kDa, (NDUFA9) -like, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|187540 cd05229, SDR_a3, atypical (a) SDRs, subgroup 3 Back     alignment and domain information
>gnl|CDD|187572 cd05262, SDR_a7, atypical (a) SDRs, subgroup 7 Back     alignment and domain information
>gnl|CDD|191263 pfam05368, NmrA, NmrA-like family Back     alignment and domain information
>gnl|CDD|187581 cd05273, GME-like_SDR_e, Arabidopsis thaliana GDP-mannose-3',5'-epimerase (GME)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224014 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|187548 cd05237, UDP_invert_4-6DH_SDR_e, UDP-Glcnac (UDP-linked N-acetylglucosamine) inverting 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187550 cd05239, GDP_FS_SDR_e, GDP-fucose synthetase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|215072 PLN00141, PLN00141, Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|235630 PRK05865, PRK05865, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|187580 cd05272, TDH_SDR_e, L-threonine dehydrogenase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187549 cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187553 cd05242, SDR_a8, atypical (a) SDRs, subgroup 8 Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187582 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatty acid synthase (FAS), complex (x) SDRs Back     alignment and domain information
>gnl|CDD|233570 TIGR01777, yfcH, TIGR01777 family protein Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187651 cd08947, NmrA_TMR_like_SDR_a, NmrA (a transcriptional regulator), HSCARG (an NADPH sensor), and triphenylmethane reductase (TMR) like proteins, atypical (a) SDRs Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|187658 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 2, complex (x) Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187546 cd05235, SDR_e1, extended (e) SDRs, subgroup 1 Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 100.0
PLN02214342 cinnamoyl-CoA reductase 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 100.0
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 100.0
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 100.0
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 100.0
PLN02650351 dihydroflavonol-4-reductase 100.0
PLN00198338 anthocyanidin reductase; Provisional 100.0
PLN02896353 cinnamyl-alcohol dehydrogenase 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein 100.0
PLN02427386 UDP-apiose/xylose synthase 100.0
PLN02572442 UDP-sulfoquinovose synthase 100.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 100.0
PLN02166436 dTDP-glucose 4,6-dehydratase 100.0
PLN02240352 UDP-glucose 4-epimerase 100.0
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 100.0
PLN02206442 UDP-glucuronate decarboxylase 100.0
PLN02653340 GDP-mannose 4,6-dehydratase 100.0
PLN02695370 GDP-D-mannose-3',5'-epimerase 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 100.0
PLN02260 668 probable rhamnose biosynthetic enzyme 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 100.0
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 100.0
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 100.0
PLN02583297 cinnamoyl-CoA reductase 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 100.0
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 100.0
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 100.0
PLN02686367 cinnamoyl-CoA reductase 100.0
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 100.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 100.0
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 100.0
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 100.0
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 100.0
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 100.0
PLN00016378 RNA-binding protein; Provisional 100.0
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 100.0
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 100.0
PRK05865 854 hypothetical protein; Provisional 100.0
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 100.0
CHL00194317 ycf39 Ycf39; Provisional 100.0
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 100.0
PLN02996491 fatty acyl-CoA reductase 100.0
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 100.0
PRK07201 657 short chain dehydrogenase; Provisional 100.0
PLN02778298 3,5-epimerase/4-reductase 100.0
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 100.0
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 100.0
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.98
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.97
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.96
PRK12320 699 hypothetical protein; Provisional 99.96
PLN02503605 fatty acyl-CoA reductase 2 99.96
PLN02260668 probable rhamnose biosynthetic enzyme 99.96
PRK06482276 short chain dehydrogenase; Provisional 99.96
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.95
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.94
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.94
PRK08263275 short chain dehydrogenase; Provisional 99.94
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.94
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.94
COG3320382 Putative dehydrogenase domain of multifunctional n 99.94
PRK06914280 short chain dehydrogenase; Provisional 99.94
PRK06180277 short chain dehydrogenase; Provisional 99.94
PRK05875276 short chain dehydrogenase; Provisional 99.94
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.94
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.94
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.94
PRK09135249 pteridine reductase; Provisional 99.94
PRK07775274 short chain dehydrogenase; Provisional 99.94
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.93
PRK05876275 short chain dehydrogenase; Provisional 99.93
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 99.93
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.93
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK07774250 short chain dehydrogenase; Provisional 99.93
PRK07074257 short chain dehydrogenase; Provisional 99.93
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.93
PRK07806248 short chain dehydrogenase; Provisional 99.93
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK06128300 oxidoreductase; Provisional 99.93
PRK06138252 short chain dehydrogenase; Provisional 99.93
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.93
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.93
PRK07067257 sorbitol dehydrogenase; Provisional 99.93
PRK07890258 short chain dehydrogenase; Provisional 99.93
PRK06182273 short chain dehydrogenase; Validated 99.93
PRK08628258 short chain dehydrogenase; Provisional 99.93
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.92
PRK12746254 short chain dehydrogenase; Provisional 99.92
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.92
PRK12827249 short chain dehydrogenase; Provisional 99.92
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.92
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.92
PRK06179270 short chain dehydrogenase; Provisional 99.92
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.92
PRK06701290 short chain dehydrogenase; Provisional 99.92
PRK06123248 short chain dehydrogenase; Provisional 99.92
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.92
PLN03209 576 translocon at the inner envelope of chloroplast su 99.92
PRK12828239 short chain dehydrogenase; Provisional 99.92
PRK09186256 flagellin modification protein A; Provisional 99.92
PRK12829264 short chain dehydrogenase; Provisional 99.92
PRK06194287 hypothetical protein; Provisional 99.92
PRK07060245 short chain dehydrogenase; Provisional 99.92
PRK07985294 oxidoreductase; Provisional 99.92
PLN02253280 xanthoxin dehydrogenase 99.91
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.91
PRK05993277 short chain dehydrogenase; Provisional 99.91
PRK07825273 short chain dehydrogenase; Provisional 99.91
PRK05717255 oxidoreductase; Validated 99.91
PRK09134258 short chain dehydrogenase; Provisional 99.91
PRK12937245 short chain dehydrogenase; Provisional 99.91
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.91
PRK07856252 short chain dehydrogenase; Provisional 99.91
PRK06500249 short chain dehydrogenase; Provisional 99.91
PRK07024257 short chain dehydrogenase; Provisional 99.91
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.91
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK06841255 short chain dehydrogenase; Provisional 99.91
PRK07478254 short chain dehydrogenase; Provisional 99.91
PRK06181263 short chain dehydrogenase; Provisional 99.91
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.91
PRK07035252 short chain dehydrogenase; Provisional 99.91
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.91
PRK08219227 short chain dehydrogenase; Provisional 99.91
PRK09291257 short chain dehydrogenase; Provisional 99.91
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.91
PRK06114254 short chain dehydrogenase; Provisional 99.91
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.91
PRK08277278 D-mannonate oxidoreductase; Provisional 99.91
PRK07454241 short chain dehydrogenase; Provisional 99.91
PRK07063260 short chain dehydrogenase; Provisional 99.9
PRK06523260 short chain dehydrogenase; Provisional 99.9
PRK12939250 short chain dehydrogenase; Provisional 99.9
PRK08589272 short chain dehydrogenase; Validated 99.9
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.9
PRK05867253 short chain dehydrogenase; Provisional 99.9
PRK08264238 short chain dehydrogenase; Validated 99.9
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.9
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.9
COG0300265 DltE Short-chain dehydrogenases of various substra 99.9
PRK06139330 short chain dehydrogenase; Provisional 99.9
PRK06196315 oxidoreductase; Provisional 99.9
PRK07109334 short chain dehydrogenase; Provisional 99.9
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.9
PRK06172253 short chain dehydrogenase; Provisional 99.9
PRK08265261 short chain dehydrogenase; Provisional 99.9
PRK06398258 aldose dehydrogenase; Validated 99.9
PRK12744257 short chain dehydrogenase; Provisional 99.9
PRK07814263 short chain dehydrogenase; Provisional 99.9
PRK12747252 short chain dehydrogenase; Provisional 99.9
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.9
PRK06101240 short chain dehydrogenase; Provisional 99.9
PRK12743256 oxidoreductase; Provisional 99.9
PRK05650270 short chain dehydrogenase; Provisional 99.9
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.9
PRK05866293 short chain dehydrogenase; Provisional 99.9
PRK08643256 acetoin reductase; Validated 99.9
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.9
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 99.9
PRK08251248 short chain dehydrogenase; Provisional 99.89
PRK07576264 short chain dehydrogenase; Provisional 99.89
PRK08339263 short chain dehydrogenase; Provisional 99.89
PRK07577234 short chain dehydrogenase; Provisional 99.89
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK09242257 tropinone reductase; Provisional 99.89
PRK07326237 short chain dehydrogenase; Provisional 99.89
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.89
PRK06947248 glucose-1-dehydrogenase; Provisional 99.89
PRK10538248 malonic semialdehyde reductase; Provisional 99.89
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.89
PRK08226263 short chain dehydrogenase; Provisional 99.89
PRK08267260 short chain dehydrogenase; Provisional 99.89
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.89
PRK08278273 short chain dehydrogenase; Provisional 99.89
PRK06197306 short chain dehydrogenase; Provisional 99.89
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.89
PRK07102243 short chain dehydrogenase; Provisional 99.89
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.89
PRK06057255 short chain dehydrogenase; Provisional 99.89
PRK05693274 short chain dehydrogenase; Provisional 99.89
KOG1221467 consensus Acyl-CoA reductase [Lipid transport and 99.88
PRK09072263 short chain dehydrogenase; Provisional 99.88
PRK07677252 short chain dehydrogenase; Provisional 99.88
PRK12742237 oxidoreductase; Provisional 99.88
PRK08017256 oxidoreductase; Provisional 99.88
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.88
PRK07062265 short chain dehydrogenase; Provisional 99.88
PRK08324681 short chain dehydrogenase; Validated 99.88
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.88
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.88
PRK06949258 short chain dehydrogenase; Provisional 99.88
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.88
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.88
PRK07904253 short chain dehydrogenase; Provisional 99.87
PRK05854313 short chain dehydrogenase; Provisional 99.87
PRK05872296 short chain dehydrogenase; Provisional 99.87
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.87
PRK06198260 short chain dehydrogenase; Provisional 99.87
PRK07069251 short chain dehydrogenase; Validated 99.87
PRK07041230 short chain dehydrogenase; Provisional 99.87
PRK08936261 glucose-1-dehydrogenase; Provisional 99.87
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.87
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.87
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.87
PRK06483236 dihydromonapterin reductase; Provisional 99.87
PRK08703239 short chain dehydrogenase; Provisional 99.87
PRK07791286 short chain dehydrogenase; Provisional 99.87
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.87
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.87
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.87
PRK07831262 short chain dehydrogenase; Provisional 99.87
KOG2774366 consensus NAD dependent epimerase [General functio 99.87
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.87
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.86
PRK06484520 short chain dehydrogenase; Validated 99.86
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.86
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 99.86
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.86
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.86
PRK07023243 short chain dehydrogenase; Provisional 99.86
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.86
PRK06924251 short chain dehydrogenase; Provisional 99.86
PRK06125259 short chain dehydrogenase; Provisional 99.85
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.85
PRK07832272 short chain dehydrogenase; Provisional 99.85
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.85
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.85
PRK07201657 short chain dehydrogenase; Provisional 99.85
PRK08340259 glucose-1-dehydrogenase; Provisional 99.85
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.84
PRK06940275 short chain dehydrogenase; Provisional 99.84
PRK05855582 short chain dehydrogenase; Validated 99.84
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.84
PRK07578199 short chain dehydrogenase; Provisional 99.84
PLN02780320 ketoreductase/ oxidoreductase 99.84
PRK06953222 short chain dehydrogenase; Provisional 99.84
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.84
PRK08303305 short chain dehydrogenase; Provisional 99.84
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.83
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.83
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.83
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 99.83
PRK06484 520 short chain dehydrogenase; Validated 99.82
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.82
PRK12367245 short chain dehydrogenase; Provisional 99.82
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.82
PRK05599246 hypothetical protein; Provisional 99.82
KOG0725270 consensus Reductases with broad range of substrate 99.82
PRK05884223 short chain dehydrogenase; Provisional 99.82
PRK08177225 short chain dehydrogenase; Provisional 99.81
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.81
PRK08862227 short chain dehydrogenase; Provisional 99.8
COG2910211 Putative NADH-flavin reductase [General function p 99.8
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.79
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.79
PRK09009235 C factor cell-cell signaling protein; Provisional 99.79
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.79
PLN00015308 protochlorophyllide reductase 99.79
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 99.78
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.78
KOG1208314 consensus Dehydrogenases with different specificit 99.78
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.75
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 99.71
COG1028251 FabG Dehydrogenases with different specificities ( 99.7
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.7
KOG3019315 consensus Predicted nucleoside-diphosphate sugar e 99.69
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.69
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.68
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 99.67
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.65
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.64
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.64
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 99.63
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.63
KOG4288283 consensus Predicted oxidoreductase [General functi 99.6
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 99.5
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 99.5
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.48
PRK06720169 hypothetical protein; Provisional 99.47
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 99.46
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 99.41
PTZ00325321 malate dehydrogenase; Provisional 99.32
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 99.2
PRK08309177 short chain dehydrogenase; Provisional 99.19
PLN00106323 malate dehydrogenase 99.16
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.03
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 99.01
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 99.01
COG0623259 FabI Enoyl-[acyl-carrier-protein] 98.97
PRK09620229 hypothetical protein; Provisional 98.92
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.79
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 98.7
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.68
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.66
PRK05086312 malate dehydrogenase; Provisional 98.64
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.6
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.53
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 98.51
PRK14982340 acyl-ACP reductase; Provisional 98.44
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 98.42
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 98.41
KOG2733 423 consensus Uncharacterized membrane protein [Functi 98.39
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.36
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 98.32
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 98.23
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 98.18
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 98.16
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 98.12
COG0569225 TrkA K+ transport systems, NAD-binding component [ 98.11
COG3268382 Uncharacterized conserved protein [Function unknow 98.09
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 98.03
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.0
COG4982 866 3-oxoacyl-[acyl-carrier protein] 97.99
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 97.98
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 97.93
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 97.92
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 97.92
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.9
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 97.9
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 97.9
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 97.89
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 97.88
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.88
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 97.87
PTZ00082321 L-lactate dehydrogenase; Provisional 97.79
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 97.76
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.76
PRK05442326 malate dehydrogenase; Provisional 97.73
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.73
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 97.7
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 97.67
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 97.66
PTZ00117319 malate dehydrogenase; Provisional 97.65
PRK09496 453 trkA potassium transporter peripheral membrane com 97.63
PRK09496453 trkA potassium transporter peripheral membrane com 97.6
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.58
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 97.57
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 97.55
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 97.55
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 97.54
PRK00048257 dihydrodipicolinate reductase; Provisional 97.53
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 97.52
PRK04148134 hypothetical protein; Provisional 97.51
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 97.5
PRK06223307 malate dehydrogenase; Reviewed 97.5
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.5
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.46
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like 97.42
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 97.41
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 97.39
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.39
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 97.38
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 97.37
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 97.35
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.35
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 97.34
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.34
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.34
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 97.34
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.34
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 97.32
COG2085211 Predicted dinucleotide-binding enzymes [General fu 97.3
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.29
PLN02602350 lactate dehydrogenase 97.29
PRK08328231 hypothetical protein; Provisional 97.29
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 97.28
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.26
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 97.24
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 97.23
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.23
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 97.22
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 97.22
PLN00112444 malate dehydrogenase (NADP); Provisional 97.22
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 97.22
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 97.2
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.17
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 97.17
PLN02383344 aspartate semialdehyde dehydrogenase 97.16
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 97.15
PRK08223287 hypothetical protein; Validated 97.12
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.1
PRK08057248 cobalt-precorrin-6x reductase; Reviewed 97.09
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 97.07
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.06
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 97.05
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.05
PRK13940414 glutamyl-tRNA reductase; Provisional 97.04
cd01483143 E1_enzyme_family Superfamily of activating enzymes 97.03
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 97.03
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.02
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.02
PRK05600370 thiamine biosynthesis protein ThiF; Validated 97.01
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.0
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 96.99
PRK15116268 sulfur acceptor protein CsdL; Provisional 96.99
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.97
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.97
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.96
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.94
PRK10669558 putative cation:proton antiport protein; Provision 96.94
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.93
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 96.9
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 96.89
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 96.89
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.89
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.89
PRK08655 437 prephenate dehydrogenase; Provisional 96.88
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 96.88
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 96.87
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.83
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 96.83
PRK06849389 hypothetical protein; Provisional 96.83
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 96.83
PRK03659601 glutathione-regulated potassium-efflux system prot 96.82
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.82
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 96.81
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 96.81
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 96.81
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 96.81
PRK12480330 D-lactate dehydrogenase; Provisional 96.79
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 96.78
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.77
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.77
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.77
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 96.76
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.75
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 96.73
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.73
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 96.7
PRK08040336 putative semialdehyde dehydrogenase; Provisional 96.69
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.68
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 96.67
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.64
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 96.63
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCA 96.62
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 96.61
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.61
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.61
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 96.6
PLN03139386 formate dehydrogenase; Provisional 96.58
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 96.57
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.57
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 96.55
PRK13302271 putative L-aspartate dehydrogenase; Provisional 96.55
PRK07877 722 hypothetical protein; Provisional 96.53
TIGR02717 447 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP 96.53
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.51
PRK07411390 hypothetical protein; Validated 96.5
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 96.5
KOG1494345 consensus NAD-dependent malate dehydrogenase [Ener 96.5
PRK03562621 glutathione-regulated potassium-efflux system prot 96.49
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.48
PLN00203519 glutamyl-tRNA reductase 96.48
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 96.47
PRK07574385 formate dehydrogenase; Provisional 96.46
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 96.46
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.46
PRK08229341 2-dehydropantoate 2-reductase; Provisional 96.45
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.45
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.44
PTZ00075476 Adenosylhomocysteinase; Provisional 96.44
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.44
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.43
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 96.43
KOG0172 445 consensus Lysine-ketoglutarate reductase/saccharop 96.42
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 96.41
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 96.4
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.39
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.39
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.39
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 96.38
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.36
PLN02948 577 phosphoribosylaminoimidazole carboxylase 96.36
PLN02928347 oxidoreductase family protein 96.35
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 96.34
PRK13243333 glyoxylate reductase; Reviewed 96.33
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 96.33
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.33
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 96.32
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 96.32
PRK06719157 precorrin-2 dehydrogenase; Validated 96.29
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.29
PRK13303265 L-aspartate dehydrogenase; Provisional 96.28
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 96.28
PF02571249 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: 96.27
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.1e-52  Score=348.91  Aligned_cols=312  Identities=48%  Similarity=0.818  Sum_probs=274.4

Q ss_pred             CCceEEEeCccchHHHHHHHHHHHCCCEEEEEecCCCchHHhHHHhcccCCCCceEEEEccCCChhhHHHHhcCccEEEE
Q 021154            4 EAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTGVFH   83 (316)
Q Consensus         4 ~~~~vlItGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~v~~Di~~~~~~~~~~~~~d~Vi~   83 (316)
                      .+++|+||||+||||+++++.|+++||+|++++|++++....+++.++.....++..+.+|++|.+++..++++||+|||
T Consensus         5 ~~~~VcVTGAsGfIgswivk~LL~rGY~V~gtVR~~~~~k~~~~L~~l~~a~~~l~l~~aDL~d~~sf~~ai~gcdgVfH   84 (327)
T KOG1502|consen    5 EGKKVCVTGASGFIGSWIVKLLLSRGYTVRGTVRDPEDEKKTEHLRKLEGAKERLKLFKADLLDEGSFDKAIDGCDGVFH   84 (327)
T ss_pred             CCcEEEEeCCchHHHHHHHHHHHhCCCEEEEEEcCcchhhhHHHHHhcccCcccceEEeccccccchHHHHHhCCCEEEE
Confidence            57899999999999999999999999999999999988776678888887677899999999999999999999999999


Q ss_pred             cccCCccCCCCCchhhhhhHHHHHHHHHHHHhhhCC-cCEEEEecccceecCC-CCCCCCccccCCCCCChhH-------
Q 021154           84 LASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALG-VKRVVVTSSISSITPS-PKWPADKVKDEDCWTDEEY-------  154 (316)
Q Consensus        84 ~a~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~-~~~~v~~SS~~~~~~~-~~~~~~~~~~e~~~~~~~~-------  154 (316)
                      .|.+..+.... ...+..+..+.|+.|++++|++.. ++|+|++||++++... +.......++|+.|.++.+       
T Consensus        85 ~Asp~~~~~~~-~e~~li~pav~Gt~nVL~ac~~~~sVkrvV~TSS~aAv~~~~~~~~~~~vvdE~~wsd~~~~~~~~~~  163 (327)
T KOG1502|consen   85 TASPVDFDLED-PEKELIDPAVKGTKNVLEACKKTKSVKRVVYTSSTAAVRYNGPNIGENSVVDEESWSDLDFCRCKKLW  163 (327)
T ss_pred             eCccCCCCCCC-cHHhhhhHHHHHHHHHHHHHhccCCcceEEEeccHHHhccCCcCCCCCcccccccCCcHHHHHhhHHH
Confidence            99987664333 444789999999999999999887 9999999999888765 3344477899999987764       


Q ss_pred             hhhcHHHHHHHHHHHHHhCCccEEEEcCCcccCCCCCCCCchhHHHHHHHHcCCCCCCCCCCCCcccHHHHHHHHHHhhc
Q 021154          155 CRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGSVHFKDVALAHILVYE  234 (316)
Q Consensus       155 y~~~k~~~e~~~~~~~~~~~~~~~~lRp~~v~g~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~i~v~D~a~~~~~~~~  234 (316)
                      |..+|..+|+.+++++++.+++.+.+.|+.|+||...+........+.++++|..-.++.....||||+|+|++++.|++
T Consensus       164 Y~~sK~lAEkaAw~fa~e~~~~lv~inP~lV~GP~l~~~l~~s~~~~l~~i~G~~~~~~n~~~~~VdVrDVA~AHv~a~E  243 (327)
T KOG1502|consen  164 YALSKTLAEKAAWEFAKENGLDLVTINPGLVFGPGLQPSLNSSLNALLKLIKGLAETYPNFWLAFVDVRDVALAHVLALE  243 (327)
T ss_pred             HHHHHHHHHHHHHHHHHhCCccEEEecCCceECCCcccccchhHHHHHHHHhcccccCCCCceeeEeHHHHHHHHHHHHc
Confidence            88999999999999999999999999999999999888666566778888888777777777779999999999999999


Q ss_pred             CCCCCcceEEecCccCHHHHHHHHHHHCCCCCCCCCCCCC-CCCccccccchhHHHhhC-CcccChhhHHHHHHHHHHHc
Q 021154          235 NPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDT-QPGLLRTKDGAKKLMDLG-LQFIPMDQIIKDSVESLKAK  312 (316)
Q Consensus       235 ~~~~~~~~~~~~~~~s~~~~~~~i~~~~~~~~~~~~~~~~-~~~~~~~~~~~~k~~~lg-~~~~~~~~~i~~~~~~~~~~  312 (316)
                      .+.+.|+|++.++..++.|+++.+.+.+|.+++|...... ........++++|++.|| |+++++++.+.++++++++.
T Consensus       244 ~~~a~GRyic~~~~~~~~ei~~~l~~~~P~~~ip~~~~~~~~~~~~~~~~~~~k~k~lg~~~~~~l~e~~~dt~~sl~~~  323 (327)
T KOG1502|consen  244 KPSAKGRYICVGEVVSIKEIADILRELFPDYPIPKKNAEEHEGFLTSFKVSSEKLKSLGGFKFRPLEETLSDTVESLREK  323 (327)
T ss_pred             CcccCceEEEecCcccHHHHHHHHHHhCCCCCCCCCCCccccccccccccccHHHHhcccceecChHHHHHHHHHHHHHh
Confidence            9999999999999888999999999999988877666655 344555679999998887 66799999999999999999


Q ss_pred             CCCC
Q 021154          313 GFIS  316 (316)
Q Consensus       313 ~~~~  316 (316)
                      ++++
T Consensus       324 ~~l~  327 (327)
T KOG1502|consen  324 GLLL  327 (327)
T ss_pred             cCCC
Confidence            9874



>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG3019 consensus Predicted nucleoside-diphosphate sugar epimerase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05295 MDH_like Malate dehydrogenase-like Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
2c29_D337 Structure Of Dihydroflavonol Reductase From Vitis V 5e-42
2rh8_A338 Structure Of Apo Anthocyanidin Reductase From Vitis 9e-28
2p4h_X322 Crystal Structure Of Vestitone Reductase From Alfal 5e-25
1ujm_A342 Crystal Structure Of Aldehyde Reductase 2 From Spor 9e-05
1y1p_A342 X-Ray Structure Of Aldehyde Reductase With Nadph Le 1e-04
>pdb|2C29|D Chain D, Structure Of Dihydroflavonol Reductase From Vitis Vinifera At 1.8 A. Length = 337 Back     alignment and structure

Iteration: 1

Score = 167 bits (424), Expect = 5e-42, Method: Compositional matrix adjust. Identities = 106/329 (32%), Positives = 161/329 (48%), Gaps = 18/329 (5%) Query: 1 MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRL 60 M ++E VCVTG SG IGSWLV LLER YTV ATV++ ++ ++ HL L A+T L L Sbjct: 1 MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTL 60 Query: 61 FQXXXXXXXXXXXXVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVL-TAAKALG 119 ++ + GCTGVFH+A+P + +DP+N+++ P ++G + ++ + A A Sbjct: 61 WKADLADEGSFDEAIKGCTGVFHVATPMDFES-KDPENEVIKPTIEGMLGIMKSCAAAKT 119 Query: 120 VKRXXXXXXX-XXXXXXXKWPADKVKDEDCWTDEEYCRQ----------NETLXXXXXXX 168 V+R + P V DE CW+D E+CR ++TL Sbjct: 120 VRRLVFTSSAGTVNIQEHQLP---VYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWK 176 Query: 169 XXXXXGLDVVVVNPGTVMGPVIPPTLNASXXXXXXXXQGCTDTYENFFMGS-VHFKDVAL 227 +D + + P V+GP I ++ S G Y G VH D+ Sbjct: 177 YAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCN 236 Query: 228 AHILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKK 287 AHI ++ENP A GR++C D + E YPEY+IP K L +KK Sbjct: 237 AHIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKK 296 Query: 288 LMDLGLQF-IPMDQIIKDSVESLKAKGFI 315 L DLG +F ++ + +V++ +AKG + Sbjct: 297 LTDLGFEFKYSLEDMFTGAVDTCRAKGLL 325
>pdb|2RH8|A Chain A, Structure Of Apo Anthocyanidin Reductase From Vitis Vinifera Length = 338 Back     alignment and structure
>pdb|2P4H|X Chain X, Crystal Structure Of Vestitone Reductase From Alfalfa (Medicago Sativa L.) Length = 322 Back     alignment and structure
>pdb|1UJM|A Chain A, Crystal Structure Of Aldehyde Reductase 2 From Sporobolomyces Salmonicolor Aku4429 Length = 342 Back     alignment and structure
>pdb|1Y1P|A Chain A, X-Ray Structure Of Aldehyde Reductase With Nadph Length = 342 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 1e-153
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 1e-148
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 1e-146
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 1e-116
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 9e-69
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 2e-67
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 3e-30
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 6e-29
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 4e-28
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 1e-22
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 2e-22
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 9e-22
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 1e-21
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 2e-21
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 7e-21
1xq6_A253 Unknown protein; structural genomics, protein stru 1e-20
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 2e-20
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 3e-20
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 4e-20
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 8e-20
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 9e-20
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 2e-19
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 4e-19
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 2e-18
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 9e-18
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 1e-17
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 2e-17
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 3e-17
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 3e-17
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 3e-16
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 5e-15
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 2e-14
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 6e-14
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 7e-14
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 2e-13
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 2e-13
3slg_A372 PBGP3 protein; structural genomics, seattle struct 1e-12
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 2e-12
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 3e-12
2wm3_A299 NMRA-like family domain containing protein 1; unkn 3e-12
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 7e-11
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 1e-10
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 2e-10
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 2e-10
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 3e-10
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 3e-10
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 4e-10
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 1e-09
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 1e-09
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 3e-09
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 3e-08
3ius_A286 Uncharacterized conserved protein; APC63810, silic 6e-08
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 6e-08
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 1e-07
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 1e-07
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 1e-07
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 3e-07
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 7e-07
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 1e-06
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 1e-06
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 1e-06
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 2e-06
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 2e-06
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 4e-06
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 5e-06
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 7e-06
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 9e-06
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 1e-05
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 1e-05
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 2e-05
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 4e-05
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 4e-05
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 7e-05
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 7e-05
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 8e-05
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 9e-05
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 1e-04
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 1e-04
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 2e-04
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 5e-04
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 7e-04
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Length = 337 Back     alignment and structure
 Score =  432 bits (1112), Expect = e-153
 Identities = 121/328 (36%), Positives = 184/328 (56%), Gaps = 16/328 (4%)

Query: 1   MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRL 60
           M  ++E VCVTG SG IGSWLV  LLER YTV ATV++ ++ ++  HL  L  A+T L L
Sbjct: 1   MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTL 60

Query: 61  FQIDLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAA-KALG 119
           ++ DL D  +   A+ GCTGVFH+A+P   +  +DP+N+++ P ++G + ++ +   A  
Sbjct: 61  WKADLADEGSFDEAIKGCTGVFHVATPMDFE-SKDPENEVIKPTIEGMLGIMKSCAAAKT 119

Query: 120 VKRVVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNE----------TLAEKAAWEF 169
           V+R+V TSS  ++          V DE CW+D E+CR  +          TLAE+AAW++
Sbjct: 120 VRRLVFTSSAGTVNIQ--EHQLPVYDESCWSDMEFCRAKKMTAWMYFVSKTLAEQAAWKY 177

Query: 170 AKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYENFFMGS-VHFKDVALA 228
           AKE  +D + + P  V+GP I  ++  S++  L  + G    Y     G  VH  D+  A
Sbjct: 178 AKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNA 237

Query: 229 HILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKL 288
           HI ++ENP A GR++C        D    + E YPEY+IP   K     L      +KKL
Sbjct: 238 HIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKL 297

Query: 289 MDLGLQF-IPMDQIIKDSVESLKAKGFI 315
            DLG +F   ++ +   +V++ +AKG +
Sbjct: 298 TDLGFEFKYSLEDMFTGAVDTCRAKGLL 325


>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Length = 322 Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Length = 338 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Length = 342 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Length = 227 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Length = 267 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Length = 221 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Length = 206 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Length = 219 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Length = 253 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Length = 224 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Length = 364 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Length = 236 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Length = 236 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Length = 352 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Length = 369 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 3r14_A* Length = 221 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Length = 372 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Length = 345 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Length = 478 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Length = 299 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Length = 289 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Length = 286 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Length = 286 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Length = 287 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Length = 313 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Length = 344 Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Length = 343 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Length = 308 Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Length = 286 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Length = 699 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Length = 242 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Length = 337 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Length = 338 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Length = 307 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Length = 348 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Length = 346 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Length = 215 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Length = 318 Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Length = 525 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Length = 516 Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Length = 336 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Length = 496 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Length = 346 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Length = 486 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Length = 321 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Length = 511 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 100.0
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 100.0
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 100.0
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 100.0
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 100.0
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 100.0
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 100.0
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 100.0
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 100.0
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 100.0
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 100.0
3slg_A372 PBGP3 protein; structural genomics, seattle struct 100.0
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 100.0
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 100.0
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 100.0
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 100.0
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 100.0
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 100.0
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 100.0
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 100.0
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 100.0
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 100.0
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 100.0
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 100.0
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 100.0
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 100.0
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 100.0
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 100.0
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 100.0
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 100.0
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 100.0
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 100.0
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 100.0
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 100.0
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 100.0
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 100.0
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 100.0
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 100.0
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 100.0
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 100.0
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 100.0
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 100.0
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 100.0
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 100.0
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 100.0
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 100.0
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 100.0
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 100.0
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 100.0
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 100.0
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 100.0
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 100.0
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 100.0
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 100.0
3ius_A286 Uncharacterized conserved protein; APC63810, silic 100.0
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 100.0
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 100.0
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 100.0
4f6c_A427 AUSA reductase domain protein; thioester reductase 100.0
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 100.0
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 100.0
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 100.0
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 100.0
4f6l_B508 AUSA reductase domain protein; thioester reductase 100.0
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 100.0
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 100.0
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 100.0
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 100.0
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 100.0
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 100.0
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 100.0
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 100.0
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 100.0
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 100.0
1xq6_A253 Unknown protein; structural genomics, protein stru 100.0
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 100.0
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.98
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.98
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.97
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.97
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.97
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.97
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.97
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.97
1spx_A278 Short-chain reductase family member (5L265); paral 99.97
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.96
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.96
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.96
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.96
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.96
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.96
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.96
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.96
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.96
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.96
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.96
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.96
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.96
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.96
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.96
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.96
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.96
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.96
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.96
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.96
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.96
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.96
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.96
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.96
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.96
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.96
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.96
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.96
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.96
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.96
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.96
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.96
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.96
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.96
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.95
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.95
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.95
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.95
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.95
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.95
3rih_A293 Short chain dehydrogenase or reductase; structural 99.95
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.95
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.95
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.95
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.95
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.95
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.95
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.95
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.95
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.95
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.95
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.95
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.95
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.95
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.95
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.95
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.95
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.95
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.95
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.95
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.95
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.95
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.95
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.95
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.95
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.95
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.95
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.95
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.95
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.95
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.95
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.95
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.95
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.95
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.95
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.95
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.95
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.95
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.95
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.95
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.95
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.95
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.95
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.95
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.95
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.95
3cxt_A291 Dehydrogenase with different specificities; rossma 99.95
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.95
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.95
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.95
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.95
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.95
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.95
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.95
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.95
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.95
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.95
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.95
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.95
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.95
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.95
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.95
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.95
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.95
1xkq_A280 Short-chain reductase family member (5D234); parra 99.95
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.94
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.94
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.94
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.94
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.94
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.94
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.94
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.94
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.94
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.94
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.94
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.94
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.94
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.94
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.94
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.94
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.94
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.94
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.94
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.94
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.94
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.94
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.94
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.94
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.94
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.94
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.94
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.94
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.94
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.94
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.94
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.94
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.94
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.94
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.94
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.94
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.94
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.94
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.94
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.94
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.94
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.94
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.94
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.94
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.94
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.94
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.94
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.94
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.94
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.94
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.94
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.94
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.94
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.94
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.94
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.94
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.93
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.93
4e4y_A244 Short chain dehydrogenase family protein; structur 99.93
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.93
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.93
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.93
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.93
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.93
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.93
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.93
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.93
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.93
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.93
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.93
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.93
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.93
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.93
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.93
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.93
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.93
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.93
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.93
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.93
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.93
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.93
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.93
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.93
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.92
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.92
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.92
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.92
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.92
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.92
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.92
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.92
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.92
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.92
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.91
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.91
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.9
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.9
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.9
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.9
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.9
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.89
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.88
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.88
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.87
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 99.86
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.85
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.85
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.84
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.84
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.81
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.79
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.77
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.76
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.75
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.74
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.73
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.73
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.7
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.68
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.56
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.54
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 99.43
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 99.37
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 99.23
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.23
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 99.07
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 99.07
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.05
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 99.0
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 99.0
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 98.92
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 98.88
1lss_A140 TRK system potassium uptake protein TRKA homolog; 98.84
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 98.77
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.76
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 98.73
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.71
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 98.7
1id1_A153 Putative potassium channel protein; RCK domain, E. 98.69
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 98.65
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 98.64
3c85_A183 Putative glutathione-regulated potassium-efflux S 98.48
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.43
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 98.41
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 98.36
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 98.31
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 98.3
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 98.28
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 98.22
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 98.16
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 98.1
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.09
3tl2_A315 Malate dehydrogenase; center for structural genomi 98.05
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.05
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.04
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 98.0
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.98
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 97.96
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 97.96
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.94
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.93
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 97.93
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 97.93
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 97.92
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 97.91
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.9
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.89
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 97.88
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 97.87
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.86
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.85
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 97.84
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.82
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 97.81
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.79
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.77
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 97.74
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 97.73
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 97.72
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 97.72
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 97.71
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 97.71
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.71
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.7
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 97.7
1lnq_A336 MTHK channels, potassium channel related protein; 97.68
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 97.68
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 97.68
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.67
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 97.66
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.66
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.6
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 97.6
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.59
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.59
4g65_A 461 TRK system potassium uptake protein TRKA; structur 97.59
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.57
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.57
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.57
3gms_A340 Putative NADPH:quinone reductase; structural genom 97.56
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.56
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 97.55
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 97.55
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.55
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.52
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 97.52
4eye_A342 Probable oxidoreductase; structural genomics, niai 97.52
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 97.5
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.49
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 97.49
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 97.49
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 97.48
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.44
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 97.44
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 97.44
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 97.44
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 97.44
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.43
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 97.39
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 97.39
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 97.39
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 97.38
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 97.38
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 97.37
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.37
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 97.36
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.35
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.34
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 97.34
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 97.33
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.33
4g65_A461 TRK system potassium uptake protein TRKA; structur 97.33
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 97.32
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.31
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.3
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 97.3
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.3
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 97.29
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.28
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 97.28
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 97.26
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 97.25
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 97.25
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 97.25
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 97.23
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 97.22
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 97.22
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 97.21
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.21
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 97.21
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.19
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 97.18
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.17
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.16
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 97.16
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 97.16
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 97.16
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 97.15
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 97.14
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.14
7mdh_A375 Protein (malate dehydrogenase); chloroplastic mala 97.1
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 97.1
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 97.09
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 97.09
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.05
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 97.05
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.04
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.04
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 97.04
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 97.04
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 97.03
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.03
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.02
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 97.02
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.01
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.01
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 97.0
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 97.0
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.99
3l6d_A306 Putative oxidoreductase; structural genomics, prot 96.97
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 96.97
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 96.97
3krt_A456 Crotonyl COA reductase; structural genomics, prote 96.96
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.95
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 96.93
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.93
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.93
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 96.93
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.91
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.9
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 96.89
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.88
1u8x_X 472 Maltose-6'-phosphate glucosidase; structural genom 96.86
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.86
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.86
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 96.86
3qha_A296 Putative oxidoreductase; seattle structural genomi 96.85
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 96.84
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 96.84
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.84
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 96.84
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 96.84
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.83
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.83
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.82
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
Probab=100.00  E-value=8.5e-49  Score=343.53  Aligned_cols=313  Identities=37%  Similarity=0.642  Sum_probs=231.6

Q ss_pred             CCCCCceEEEeCccchHHHHHHHHHHHCCCEEEEEecCCCchHHhHHHhcccCCCCceEEEEccCCChhhHHHHhcCccE
Q 021154            1 MSKEAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQIDLLDYDAIAAAVTGCTG   80 (316)
Q Consensus         1 m~~~~~~vlItGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~v~~Di~~~~~~~~~~~~~d~   80 (316)
                      |.+++|+||||||+||||++|+++|+++|++|+++.|++........+..+.....+++++++|++|.+++.++++++|+
T Consensus         1 ~~~~~~~vlVTGatGfIG~~l~~~L~~~G~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~d~~~~~~~~~~~d~   80 (337)
T 2c29_D            1 MGSQSETVCVTGASGFIGSWLVMRLLERGYTVRATVRDPTNVKKVKHLLDLPKAETHLTLWKADLADEGSFDEAIKGCTG   80 (337)
T ss_dssp             -----CEEEETTTTSHHHHHHHHHHHHTTCEEEEEESCTTCHHHHHHHHTSTTHHHHEEEEECCTTSTTTTHHHHTTCSE
T ss_pred             CCCCCCEEEEECCchHHHHHHHHHHHHCCCEEEEEECCcchhHHHHHHHhcccCCCeEEEEEcCCCCHHHHHHHHcCCCE
Confidence            77788999999999999999999999999999999998654322222222211112588999999999999999999999


Q ss_pred             EEEcccCCccCCCCCchhhhhhHHHHHHHHHHHHhhhCC-cCEEEEecccceecCCCCCCCCccccCCCCCC--------
Q 021154           81 VFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALG-VKRVVVTSSISSITPSPKWPADKVKDEDCWTD--------  151 (316)
Q Consensus        81 Vi~~a~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~-~~~~v~~SS~~~~~~~~~~~~~~~~~e~~~~~--------  151 (316)
                      |||+|+.... ...+.....+++|+.++.+++++|++.+ +++|||+||.+++++....  ..+++|+.+..        
T Consensus        81 Vih~A~~~~~-~~~~~~~~~~~~nv~gt~~ll~a~~~~~~~~riV~~SS~~~~~~~~~~--~~~~~E~~~~~~~~~~~~~  157 (337)
T 2c29_D           81 VFHVATPMDF-ESKDPENEVIKPTIEGMLGIMKSCAAAKTVRRLVFTSSAGTVNIQEHQ--LPVYDESCWSDMEFCRAKK  157 (337)
T ss_dssp             EEECCCCCCS-SCSSHHHHTHHHHHHHHHHHHHHHHHHSCCCEEEEECCGGGTSCSSSC--CSEECTTCCCCHHHHHHHC
T ss_pred             EEEeccccCC-CCCChHHHHHHHHHHHHHHHHHHHHhCCCccEEEEeeeHhhcccCCCC--CcccCcccCCchhhhcccC
Confidence            9999987522 1223334688999999999999998877 8999999999766654321  34677776432        


Q ss_pred             -h-hHhhhcHHHHHHHHHHHHHhCCccEEEEcCCcccCCCCCCCCchhHHHHHHHHcCCCCCCCC-CCCCcccHHHHHHH
Q 021154          152 -E-EYCRQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLNASMLMLLRLLQGCTDTYEN-FFMGSVHFKDVALA  228 (316)
Q Consensus       152 -~-~~y~~~k~~~e~~~~~~~~~~~~~~~~lRp~~v~g~~~~~~~~~~~~~~~~~~~g~~~~~~~-~~~~~i~v~D~a~~  228 (316)
                       | ..|+.+|.++|.+++.++++++++++++||+++|||+.................|....++. ....|+|++|+|++
T Consensus       158 ~~~~~Y~~sK~~~E~~~~~~~~~~gi~~~~lrp~~v~Gp~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~v~Dva~a  237 (337)
T 2c29_D          158 MTAWMYFVSKTLAEQAAWKYAKENNIDFITIIPTLVVGPFIMSSMPPSLITALSPITGNEAHYSIIRQGQFVHLDDLCNA  237 (337)
T ss_dssp             CTTHHHHHHHHHHHHHHHHHHHHHTCCEEEEEECEEESCCSCSSCCHHHHHHTHHHHTCGGGHHHHTEEEEEEHHHHHHH
T ss_pred             CccchHHHHHHHHHHHHHHHHHHcCCcEEEEeCCceECCCCCCCCCchHHHHHHHHcCCCccccccCCCCEEEHHHHHHH
Confidence             2 26999999999999998877799999999999999986544322211111123343222111 12239999999999


Q ss_pred             HHHhhcCCCCCcceEEecCccCHHHHHHHHHHHCCCCCCCCCCCCCCCCccccccchhHHHhhCCcc-cChhhHHHHHHH
Q 021154          229 HILVYENPSACGRHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGLLRTKDGAKKLMDLGLQF-IPMDQIIKDSVE  307 (316)
Q Consensus       229 ~~~~~~~~~~~~~~~~~~~~~s~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~lg~~~-~~~~~~i~~~~~  307 (316)
                      ++.+++++...+.|+++++.+|+.|+++.+.+.++...++..............+|++|++.|||+| ++++++|+++++
T Consensus       238 ~~~~~~~~~~~~~~~~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~d~~k~~~lG~~p~~~l~e~l~~~~~  317 (337)
T 2c29_D          238 HIYLFENPKAEGRYICSSHDCIILDLAKMLREKYPEYNIPTEFKGVDENLKSVCFSSKKLTDLGFEFKYSLEDMFTGAVD  317 (337)
T ss_dssp             HHHHHHCTTCCEEEEECCEEEEHHHHHHHHHHHCTTSCCCSCCTTCCTTCCCCEECCHHHHHHTCCCCCCHHHHHHHHHH
T ss_pred             HHHHhcCcccCceEEEeCCCCCHHHHHHHHHHHCCCccCCCCCCcccCCCccccccHHHHHHcCCCcCCCHHHHHHHHHH
Confidence            9999987666677888877899999999999988654444322222233445778999998899999 899999999999


Q ss_pred             HHHHcCCCC
Q 021154          308 SLKAKGFIS  316 (316)
Q Consensus       308 ~~~~~~~~~  316 (316)
                      |+++.+.+|
T Consensus       318 ~~~~~~~~~  326 (337)
T 2c29_D          318 TCRAKGLLP  326 (337)
T ss_dssp             HHHHTTSSC
T ss_pred             HHHHcCCCC
Confidence            999988764



>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 1e-34
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 2e-28
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 3e-27
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 5e-26
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 5e-22
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-20
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 2e-20
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 4e-19
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 7e-19
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 2e-18
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 2e-18
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 2e-18
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 1e-17
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 3e-16
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 4e-15
d1hdoa_205 c.2.1.2 (A:) Biliverdin IX beta reductase {Human ( 6e-15
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 1e-14
d1xgka_350 c.2.1.2 (A:) Negative transcriptional regulator Nm 3e-13
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 1e-12
d1qyca_307 c.2.1.2 (A:) Phenylcoumaran benzylic ether reducta 3e-11
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 1e-09
d1rkxa_356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 2e-09
d1eq2a_307 c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimer 8e-09
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 1e-08
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 2e-08
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 2e-08
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 4e-08
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 1e-07
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 3e-07
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 7e-07
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 7e-07
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-06
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 1e-06
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 1e-06
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-06
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 3e-06
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 3e-06
d1vl0a_281 c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD 3e-06
d2blla1342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 7e-06
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 1e-05
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-05
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 1e-05
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 3e-05
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 3e-05
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 3e-05
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 5e-05
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 8e-05
d1gy8a_383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 1e-04
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 1e-04
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 1e-04
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 2e-04
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-04
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 2e-04
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 2e-04
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-04
d1n2sa_298 c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reduct 2e-04
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 2e-04
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 2e-04
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 3e-04
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 3e-04
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-04
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 4e-04
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 4e-04
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 4e-04
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 5e-04
d2bkaa1232 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {H 6e-04
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 7e-04
d2a35a1212 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pse 0.001
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 0.001
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 0.001
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 0.002
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 0.002
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 0.002
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Aldehyde reductase II
species: Sporobolomyces salmonicolor [TaxId: 5005]
 Score =  126 bits (317), Expect = 1e-34
 Identities = 80/336 (23%), Positives = 116/336 (34%), Gaps = 31/336 (9%)

Query: 4   EAEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDERETAHLKALEGADTRLRLFQI 63
           E  +V VTG +G + S +V  LLE  Y V  T ++ S           +           
Sbjct: 10  EGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVE 69

Query: 64  DLLDYDAIAAAVTGCTGVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVL-TAAKALGVKR 122
           D+L   A    + G  GV H      V    +  ++++ PA+ GT+N L  AA    VKR
Sbjct: 70  DMLKQGAYDEVIKGAAGVAH---IASVVSFSNKYDEVVTPAIGGTLNALRAAAATPSVKR 126

Query: 123 VVVTSSISSITPSPKWPADKVKDEDCWTDEEYCRQNE-----------------TLAEKA 165
            V+TSS  S             DE  W  E   +                    T AE A
Sbjct: 127 FVLTSSTVSALIPKPNVEGIYLDEKSWNLESIDKAKTLPESDPQKSLWVYAASKTEAELA 186

Query: 166 AWEFAKEKGL--DVVVVNPGTVMGPVIPPTLNA--SMLMLLRLLQGCTDTYEN--FFMGS 219
           AW+F  E      +  V P   +G +  P   +  +   ++ L  G              
Sbjct: 187 AWKFMDENKPHFTLNAVLPNYTIGTIFDPETQSGSTSGWMMSLFNGEVSPALALMPPQYY 246

Query: 220 VHFKDVALAHILVYENPSACG-RHLCVEAISHYGDFVAKVAELYPEYDIPRLPKDTQPGL 278
           V   D+ L H+     P     R         +   +A   +LYP    P    D    L
Sbjct: 247 VSAVDIGLLHLGCLVLPQIERRRVYGTAGTFDWNTVLATFRKLYPSKTFPADFPDQGQDL 306

Query: 279 --LRTKDGAKKLMDLGLQ-FIPMDQIIKDSVESLKA 311
               T    + L  LG   +  +++ IKD V S  A
Sbjct: 307 SKFDTAPSLEILKSLGRPGWRSIEESIKDLVGSETA 342


>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Length = 307 Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Length = 307 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Length = 281 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Length = 298 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Length = 212 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 100.0
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 100.0
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 100.0
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 100.0
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 100.0
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 100.0
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 100.0
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 100.0
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 100.0
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 100.0
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 100.0
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 100.0
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 100.0
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 100.0
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 100.0
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 100.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 100.0
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 100.0
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 100.0
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.97
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.97
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.96
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.96
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.95
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.95
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.94
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.94
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.94
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.94
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.94
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.94
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.94
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.94
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.94
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.94
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.94
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.94
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.94
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.94
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.94
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.93
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.93
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.93
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.93
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.93
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.93
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.93
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.93
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.93
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.93
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.92
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.92
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 99.92
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.92
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.92
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.92
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.92
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.92
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.92
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.91
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.91
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.91
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.91
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.91
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.91
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.91
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.91
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.9
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.9
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.9
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.9
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.89
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.89
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.88
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.88
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.88
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.87
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.86
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.85
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.84
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.83
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.83
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.82
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.81
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.81
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.8
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.79
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.79
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.75
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.73
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.72
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.67
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.54
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 98.66
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 98.61
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 98.45
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.42
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 98.36
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 98.26
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 98.23
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 98.22
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 98.22
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 98.21
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 98.15
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 98.07
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 98.0
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.97
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 97.97
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.97
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.97
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 97.96
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 97.95
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.93
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.91
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 97.9
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 97.9
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 97.89
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.89
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.88
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 97.86
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.85
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.83
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 97.83
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 97.82
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.76
d1id1a_153 Rck domain from putative potassium channel Kch {Es 97.73
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.72
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 97.71
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.68
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 97.66
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 97.63
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.61
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.6
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 97.59
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 97.59
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.54
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.54
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 97.53
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.53
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 97.51
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.49
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 97.46
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.41
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 97.39
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 97.37
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.37
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 97.29
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.29
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 97.28
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.27
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.26
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 97.19
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 97.14
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.13
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.1
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.05
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.01
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.0
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.97
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.96
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.91
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.91
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 96.9
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.87
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 96.86
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.85
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.85
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.84
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.79
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.76
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 96.72
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.66
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.64
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.58
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 96.57
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.57
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 96.56
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 96.55
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.55
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 96.54
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 96.53
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.52
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.51
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 96.5
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 96.5
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 96.48
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.46
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 96.45
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.44
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.43
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.41
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 96.41
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.4
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.39
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.38
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.38
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.37
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.35
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 96.33
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.33
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.33
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.31
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.3
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 96.29
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.29
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.27
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.26
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 96.24
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.21
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.21
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.18
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.17
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.16
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.06
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 96.02
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.01
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 96.01
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.95
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.94
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 95.83
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 95.8
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.75
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 95.74
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 95.68
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 95.67
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 95.59
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 95.57
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.56
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 95.53
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 95.52
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.48
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.42
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 95.42
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 95.31
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.29
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 95.28
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.21
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 95.2
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 95.17
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 95.07
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.9
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 94.88
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 94.71
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.62
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.62
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.52
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.31
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 94.21
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 94.18
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.1
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 94.0
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 93.94
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 93.92
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.82
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 93.78
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.73
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.51
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 93.48
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.48
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.24
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 93.17
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 93.12
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.05
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.02
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 93.02
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.97
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 92.8
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.79
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 92.74
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 92.7
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 92.64
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 92.55
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 92.27
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 91.93
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 91.9
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 91.76
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.52
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.51
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 91.38
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 91.07
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 91.0
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 90.76
d2bw0a2203 10-formyltetrahydrofolate dehydrogenase domain 1 { 90.7
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 90.69
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.63
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 90.47
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 90.25
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 90.22
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 89.6
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 89.09
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 88.8
d1gsoa2105 Glycinamide ribonucleotide synthetase (GAR-syn), N 88.55
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 88.45
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.29
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.3
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 87.23
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 87.07
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 87.01
d1p3y1_183 MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} 86.92
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.57
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 86.41
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 86.11
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 85.48
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 85.28
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 85.03
d1fmta2206 Methionyl-tRNAfmet formyltransferase {Escherichia 84.82
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 84.76
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 84.47
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 84.31
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.14
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 84.13
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 84.13
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 84.12
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 84.11
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 84.02
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 83.91
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 83.73
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 83.53
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 83.39
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 83.17
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 83.13
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 83.1
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 83.03
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 82.91
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 82.7
d1xk7a1402 Crotonobetainyl-CoA:carnitine CoA-transferase, Cai 82.57
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 82.53
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 82.33
d1x74a1359 2-methylacyl-CoA racemase Mcr {Mycobacterium tuber 82.22
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 82.04
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 81.72
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 81.54
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 81.53
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 81.19
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 81.06
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 81.02
d1q7ea_417 Hypothetical protein YfdW {Escherichia coli [TaxId 80.89
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 80.88
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 80.8
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 80.31
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: GDP-mannose 4,6-dehydratase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=7.3e-48  Score=337.80  Aligned_cols=301  Identities=17%  Similarity=0.130  Sum_probs=228.8

Q ss_pred             CceEEEeCccchHHHHHHHHHHHCCCEEEEEecCCCchH--HhHHHh-cccCCCCceEEEEccCCChhhHHHHhc--Ccc
Q 021154            5 AEVVCVTGGSGCIGSWLVSLLLERRYTVHATVKNLSDER--ETAHLK-ALEGADTRLRLFQIDLLDYDAIAAAVT--GCT   79 (316)
Q Consensus         5 ~~~vlItGatG~iG~~l~~~L~~~g~~V~~~~r~~~~~~--~~~~~~-~~~~~~~~~~~v~~Di~~~~~~~~~~~--~~d   79 (316)
                      .|+|||||||||||++|+++|+++|++|++++|..+...  ....+. ......++++++++|++|.+++.++++  ++|
T Consensus         1 ~K~vLITGatGfiGs~lv~~Ll~~g~~V~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Dl~d~~~~~~~~~~~~~d   80 (357)
T d1db3a_           1 SKVALITGVTGQDGSYLAEFLLEKGYEVHGIKRRASSFNTERVDHIYQDPHTCNPKFHLHYGDLSDTSNLTRILREVQPD   80 (357)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHTTCEEEEECC---------------------CCEEECCCCSSCHHHHHHHHHHHCCS
T ss_pred             CCEEEEeCCCcHHHHHHHHHHHHCcCEEEEEECCCcccchhhHHHHHhhhhhcCCCeEEEEeecCCHHHHHHHHhccCCC
Confidence            378999999999999999999999999999998653211  111111 111224689999999999999999998  459


Q ss_pred             EEEEcccCCccCCCCCchhhhhhHHHHHHHHHHHHhhhCCc---CEEEEecccceecCCCCCCCCccccCCCCCChh-Hh
Q 021154           80 GVFHLASPCIVDKVEDPQNQLLNPAVKGTVNVLTAAKALGV---KRVVVTSSISSITPSPKWPADKVKDEDCWTDEE-YC  155 (316)
Q Consensus        80 ~Vi~~a~~~~~~~~~~~~~~~~~~n~~~~~~l~~~~~~~~~---~~~v~~SS~~~~~~~~~~~~~~~~~e~~~~~~~-~y  155 (316)
                      +|||+|+....+...+++..++++|+.|+.+|+++|++.++   ++|||+||..+| +.+.   ..+++|+++..|. +|
T Consensus        81 ~v~h~aa~~~~~~~~~~~~~~~~~Nv~gt~nllea~~~~~~~~~~r~i~~SS~~vY-G~~~---~~~~~E~~~~~P~~~Y  156 (357)
T d1db3a_          81 EVYNLGAMSHVAVSFESPEYTADVDAMGTLRLLEAIRFLGLEKKTRFYQASTSELY-GLVQ---EIPQKETTPFYPRSPY  156 (357)
T ss_dssp             EEEECCCCCTTTTTTSCHHHHHHHHTHHHHHHHHHHHHTTCTTTCEEEEEEEGGGG-TTCC---SSSBCTTSCCCCCSHH
T ss_pred             EEEEeecccccchhhhCHHHHHHHHHHHHHHHHHHHHHhCCCCCcEEEEEEchhhh-CCCC---CCCcCCCCCCCCCChH
Confidence            99999999877777888899999999999999999988764   479999998554 4443   6689999988887 89


Q ss_pred             hhcHHHHHHHHHHHHHhCCccEEEEcCCcccCCCCCCCCc--hhHHHHHHHHcCCCCC--CCC--CCCCcccHHHHHHHH
Q 021154          156 RQNETLAEKAAWEFAKEKGLDVVVVNPGTVMGPVIPPTLN--ASMLMLLRLLQGCTDT--YEN--FFMGSVHFKDVALAH  229 (316)
Q Consensus       156 ~~~k~~~e~~~~~~~~~~~~~~~~lRp~~v~g~~~~~~~~--~~~~~~~~~~~g~~~~--~~~--~~~~~i~v~D~a~~~  229 (316)
                      +.+|..+|.+++.++++++++++++||+++|||+......  .....+.....+....  .++  ..++|+|++|+|+++
T Consensus       157 ~~sK~~~E~~~~~~~~~~~l~~~ilR~~~vyGp~~~~~~~~~~i~~~~~~~~~~~~~~~~~g~~~~~r~~~~v~D~~~a~  236 (357)
T d1db3a_         157 AVAKLYAYWITVNYRESYGMYACNGILFNHESPRRGETFVTRKITRAIANIAQGLESCLYLGNMDSLRDWGHAKDYVKMQ  236 (357)
T ss_dssp             HHHHHHHHHHHHHHHHHHCCCEEEEEECCEECTTSCTTSHHHHHHHHHHHHHTTSCCCEEESCTTCEECCEEHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhCCCEEEEEeccccCCCCCcCCCchHHHHHHHHHHhCCCceEEECCCCeeecceeechHHHHH
Confidence            9999999999999999999999999999999997654432  2234445555555433  333  445699999999999


Q ss_pred             HHhhcCCCCCcceEEe-cCccCHHHHHHHHHHHCCCCC--------------------CCCCCC-----------CCCCC
Q 021154          230 ILVYENPSACGRHLCV-EAISHYGDFVAKVAELYPEYD--------------------IPRLPK-----------DTQPG  277 (316)
Q Consensus       230 ~~~~~~~~~~~~~~~~-~~~~s~~~~~~~i~~~~~~~~--------------------~~~~~~-----------~~~~~  277 (316)
                      ..+++.. .++.||++ ++.+|++|+++.+.+.++...                    .+....           .++.+
T Consensus       237 ~~~~~~~-~~~~yni~sg~~~s~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~  315 (357)
T d1db3a_         237 WMMLQQE-QPEDFVIATGVQYSVRQFVEMAAAQLGIKLRFEGTGVEEKGIVVSVTGHDAPGVKPGDVIIAVDPRYFRPAE  315 (357)
T ss_dssp             HHTTSSS-SCCCEEECCCCCEEHHHHHHHHHHTTTEEEEEESCGGGCEEEEEEECSSSCTTCCTTCEEEEECGGGCCCCC
T ss_pred             HHHHhCC-CCCeEEECCCCceehHHHHHHHHHHhCCccccccccccccchhhhhhcccccccccCceeEeeccccCCCcc
Confidence            9999875 55779875 788999999999999985210                    000000           01122


Q ss_pred             ccccccchhHH-HhhCCcc-cChhhHHHHHHHHHH
Q 021154          278 LLRTKDGAKKL-MDLGLQF-IPMDQIIKDSVESLK  310 (316)
Q Consensus       278 ~~~~~~~~~k~-~~lg~~~-~~~~~~i~~~~~~~~  310 (316)
                      ...+.+|++|+ +.|||+| ++|+|+|++++++..
T Consensus       316 ~~~~~~d~skakk~LGw~P~~sl~egI~~~I~~~l  350 (357)
T d1db3a_         316 VETLLGDPTKAHEKLGWKPEITLREMVSEMVANDL  350 (357)
T ss_dssp             -CCCCBCCHHHHHHHCCCCCSCHHHHHHHHHHHHH
T ss_pred             ccccccCHHHHHHHHCCCcCCCHHHHHHHHHHHHH
Confidence            33457799999 7799999 999999999987543



>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1p3y1_ c.34.1.1 (1:) MrsD {Bacillus sp. hil-y85/54728 [TaxId: 69002]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xk7a1 c.123.1.1 (A:4-405) Crotonobetainyl-CoA:carnitine CoA-transferase, CaiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1x74a1 c.123.1.1 (A:2-360) 2-methylacyl-CoA racemase Mcr {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q7ea_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure