Citrus Sinensis ID: 021183


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MSSLWSLAPCKITLWEHYPVQPSRLSLKLAISNASENKNHSLPLKLCCCDSSDSTAVIGSTNNNSAPPVMRKKKRVRYRREYPGESKGITEEMRFVAMRLRNLKGKKYPSSPHNSNSDCEDSSNDDVEHEQEVKQDNDGETWKPSMDAFVKYLVDSQLVFNTIERIVDDSNDVAYAYFRKTGLERSEGISRDLEWFSEQGIIIPEPSTPGVSYAKYLEELAEKSAPLFLSHFYNIYFSHVAGGQVIERQVSEKILDGRKLEVYRWEGDPEEMLKDVREKLNMLGEHWTRDEKNKSLKEAAKSFKFLGQIVRLIILL
cccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*****SLAPCKITLWEHYPVQPSRLSLKLAI*********SLPLKLCCCD*************************************GITEEMRFVAM*******************************************WKPSMDAFVKYLVDSQLVFNTIERIVDDSNDVAYAYFRKTGLERSEGISRDLEWFSEQGIIIPEPSTPGVSYAKYLEELAEKSAPLFLSHFYNIYFSHVAGGQVIERQVSEKILDGRKLEVYRWEGDPEEMLKDVREKLNMLGEHWTRDEKNKSLKEAAKSFKFLGQIVRLIILL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSLWSLAPCKITLWEHYPVQPSRLSLKLAISNASENKNHSLPLKLCCCDSSDSTAVIGSTNNNSAPPVMRKKKRVRYRREYPGESKGITEEMRFVAMRLRNLKGKKYPSSPHNSNSDCEDSSNDDVEHEQEVKQDNDGETWKPSMDAFVKYLVDSQLVFNTIERIVDDSNDVAYAYFRKTGLERSEGISRDLEWFSEQGIIIPEPSTPGVSYAKYLEELAEKSAPLFLSHFYNIYFSHVAGGQVIERQVSEKILDGRKLEVYRWEGDPEEMLKDVREKLNMLGEHWTRDEKNKSLKEAAKSFKFLGQIVRLIILL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable inactive heme oxygenase 2, chloroplastic Probable inactive heme oxygenase that may play a role in the regulation of phytochrome assembly and photomorphogenesis.probableQ10K62
Probable inactive heme oxygenase 2, chloroplastic Probable inactive heme oxygenase. Binds protoporphyrin IX, a precursor for both heme and chlorophyll biosynthesis. Plays a minor role in phytochrome assembly and photomorphogenesis.probableO48722

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WZD, chain A
Confidence level:very confident
Coverage over the Query: 88-107,134-314
View the alignment between query and template
View the model in PyMOL