Citrus Sinensis ID: 021194

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MKRSLCSSDDSLGALMSICPATDEQSPRNNQVYSREFQTMLDGLDEEGCLEESGGHVSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKETIVHETDHQNKATLDRDQESDDKQAAAVAPPTNVTAISLAPAGNISDEPDQELNYDNGVLGISLFPDLKDGSSDSDSSAILNNEDNNNFHNSNNTTALTLPFLHLMVLSFRASLINFRLTASNSQNQRTRLSLSRWKSTISLVMRPAISSLMSSLLLFHGIVLISGPS
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHccEEEEcccc
ccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHccccccccccccccccccccccccHHccccccccccccccccccccccccccHHEccccccccccccccEEEEEccEEEEEcccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEcccc
mkrslcssddslGALMsicpatdeqsprnnqvYSREFQTMLdgldeegcleesgghvsekkrrLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKETIVHEtdhqnkatldrdqesddkqaaavapptnvtaislapagnisdepdqelnydngvlgislfpdlkdgssdsdssailnnednnnfhnsnnttaltlPFLHLMVLSFRASLINFRltasnsqnqRTRLSLSRWKSTISLVMRPAISSLMSSLLLFHGIVLISGPS
mkrslcssddsLGALMSicpatdeqsprnnQVYSREFQTMLDGLDEEGCLEesgghvsekkrrlsvDQVKALeknfevenkleperKVKLaqelglqprqvavwfqnrrarwktkqlerdyGVLKANYDALKLNYDSLQHDNEALLKETIVHETDHQNKATLDRDQESDDKQAAAVAPPTNVTAISLAPAGNISDEPDQELNYDNGVLGISLFPDLKDGSSDSDSSAILNNEDNNNFHNSNNTTALTLPFLHLMVLSFRASLINFRltasnsqnqrtrlslsrwksTISLVMRPAISSLMSSLLLFHGIVLISGPS
MKRSLCSSDDSLGALMSICPATDEQSPRNNQVYSREFQTMldgldeegcleesggHVSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKETIVHETDHQNKATLDRDQESDDKQaaavapptnvtaISLAPAGNISDEPDQELNYDNGVLGISLFPDLKDGssdsdssAILnnednnnfhnsnnTTALTLPFLHLMVLSFRASLINFRLTASNSQNQRTRLSLSRWKSTISLVMRPAISSLMSSLLLFHGIVLISGPS
*******************************************************************************************QELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKETIV***************************************************YDNGVLGISLF*****************************TTALTLPFLHLMVLSFRASLINFRLTAS*******RLSLSRWKSTISLVMRPAISSLMSSLLLFHGIVLI****
*****************************************************************VDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRR**************************************************************************************************************************************************************************************MR*AISSLMSSLLLFHGIVLIS***
*********DSLGALMSICPATDEQSPRNNQVYSREFQTMLDGLDEEGCL************RLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKETIVHETDHQNK*******************PTNVTAISLAPAGNISDEPDQELNYDNGVLGISLFPDLKDGSSDSDSSAILNNEDNNNFHNSNNTTALTLPFLHLMVLSFRASLINFRLTASN*********LSRWKSTISLVMRPAISSLMSSLLLFHGIVLISGPS
***********************************************************KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKLNYDSLQHDNEALLKETIVHETDHQ****************************************************************************NNNFHNSNNTTALTLPFLHLMVLSFRASLINFRLTASN******RLSLSRWKSTISLVMRPAISSLMSSLLLFHGIVLISG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRSLCSSDDSLGALMSICPATDEQSPRNNQVYSREFQTMLDGLDEEGCLEESGGHVSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTIVHETDHQNKATLDRDQESDDKQAAAVAPPTNVTAISLAPAGNISDEPDQELNYDNGVLGISLFPDLKDGSSDSDSSAILNNEDNNNFHNSNNTTALTLPFLHLMVLSFRASLINFRLTASNSQNQRTRLSLSRWKSTISLVMRPAISSLMSSLLLFHGIVLISGPS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
Q940J1294 Homeobox-leucine zipper p yes no 0.680 0.731 0.518 1e-52
P46668311 Homeobox-leucine zipper p no no 0.645 0.655 0.536 4e-51
P46667312 Homeobox-leucine zipper p no no 0.462 0.467 0.651 8e-46
Q6K498277 Homeobox-leucine zipper p yes no 0.335 0.382 0.669 3e-36
Q9XH37277 Homeobox-leucine zipper p N/A no 0.335 0.382 0.669 3e-36
Q6Z248269 Homeobox-leucine zipper p no no 0.443 0.520 0.488 2e-35
A2YWC0269 Homeobox-leucine zipper p N/A no 0.443 0.520 0.488 2e-35
Q02283272 Homeobox-leucine zipper p no no 0.553 0.643 0.445 1e-32
Q8LC03294 Homeobox-leucine zipper p no no 0.420 0.452 0.503 7e-31
Q00466314 Homeobox-leucine zipper p no no 0.392 0.394 0.543 8e-31
>sp|Q940J1|ATB16_ARATH Homeobox-leucine zipper protein ATHB-16 OS=Arabidopsis thaliana GN=ATHB-16 PE=2 SV=2 Back     alignment and function desciption
 Score =  206 bits (525), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 163/249 (65%), Gaps = 34/249 (13%)

Query: 1   MKRSLCSSDDSLGALMSICPATDEQSPRNNQVYSREFQTMLDGLDEEGCL--EESGGH-- 56
           MKR   SS DS+  L+S   +TDEQSPR    Y   +Q+ML+G DE+  L  E SG H  
Sbjct: 1   MKR--LSSSDSMCGLIST--STDEQSPRG---YGSNYQSMLEGYDEDATLIEEYSGNHHH 53

Query: 57  --VSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKT 114
             +SEKKRRL VDQVKALEKNFE+ENKLEPERK KLAQELGLQPRQVAVWFQNRRARWKT
Sbjct: 54  MGLSEKKRRLKVDQVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKT 113

Query: 115 KQLERDYGVLKANYDALKLNYDSLQHDNEALLKETIVHETDHQNKATLDRDQESDDKQAA 174
           KQLE+DYGVLK  YD+L+ N+DSL+ DN++LL+E        + KA ++ ++++++ +A 
Sbjct: 114 KQLEKDYGVLKGQYDSLRHNFDSLRRDNDSLLQEI------SKIKAKVNGEEDNNNNKAI 167

Query: 175 AVAPPTNVTAISLAPAGNISDEPDQELNYDNGVLGISLFPDLKD----------GSSDS- 223
                  V    +    +I   P Q L + +G      F DL+D          GSSDS 
Sbjct: 168 TEG----VKEEEVHKTDSIPSSPLQFLEHSSGFNYRRSFTDLRDLLPNSTVVEAGSSDSC 223

Query: 224 DSSAILNNE 232
           DSSA+LN+E
Sbjct: 224 DSSAVLNDE 232
Probable transcription factor that may function as a negative regulator of the flowering time response to photoperiod. May act to repress cell expansion during plant development.
Arabidopsis thaliana (taxid: 3702)
>sp|P46668|ATHB6_ARATH Homeobox-leucine zipper protein ATHB-6 OS=Arabidopsis thaliana GN=ATHB-6 PE=1 SV=1 Back     alignment and function description
>sp|P46667|ATHB5_ARATH Homeobox-leucine zipper protein ATHB-5 OS=Arabidopsis thaliana GN=ATHB-5 PE=1 SV=1 Back     alignment and function description
>sp|Q6K498|HOX4_ORYSJ Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. japonica GN=HOX4 PE=1 SV=1 Back     alignment and function description
>sp|Q9XH37|HOX4_ORYSI Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. indica GN=HOX4 PE=1 SV=1 Back     alignment and function description
>sp|Q6Z248|HOX20_ORYSJ Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. japonica GN=HOX20 PE=2 SV=1 Back     alignment and function description
>sp|A2YWC0|HOX20_ORYSI Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. indica GN=HOX20 PE=2 SV=1 Back     alignment and function description
>sp|Q02283|HAT5_ARATH Homeobox-leucine zipper protein HAT5 OS=Arabidopsis thaliana GN=HAT5 PE=1 SV=1 Back     alignment and function description
>sp|Q8LC03|ATB13_ARATH Homeobox-leucine zipper protein ATHB-13 OS=Arabidopsis thaliana GN=ATHB-13 PE=2 SV=2 Back     alignment and function description
>sp|Q00466|HAT7_ARATH Homeobox-leucine zipper protein HAT7 OS=Arabidopsis thaliana GN=HAT7 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
118488246328 unknown [Populus trichocarpa] 0.705 0.679 0.665 1e-75
359480491335 PREDICTED: homeobox-leucine zipper prote 0.721 0.680 0.658 7e-73
147785120345 hypothetical protein VITISV_008512 [Viti 0.721 0.660 0.636 7e-72
297741835280 unnamed protein product [Vitis vinifera] 0.661 0.746 0.653 1e-69
356511080314 PREDICTED: homeobox-leucine zipper prote 0.693 0.697 0.635 5e-68
449451407324 PREDICTED: homeobox-leucine zipper prote 0.867 0.845 0.545 9e-67
4433048151 DNA-binding protein [Daucus carota] 0.458 0.960 0.824 1e-63
49659431317 SlHDL1 [Silene latifolia] 0.718 0.716 0.549 5e-63
356567620322 PREDICTED: homeobox-leucine zipper prote 0.427 0.419 0.846 1e-60
356540251314 PREDICTED: homeobox-leucine zipper prote 0.775 0.780 0.540 2e-58
>gi|118488246|gb|ABK95942.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  289 bits (740), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 167/251 (66%), Positives = 191/251 (76%), Gaps = 28/251 (11%)

Query: 1   MKRSLCSSDDSLGALMSICPATDEQSPRNN-QVYSREFQTMLDGLDEEGCLEESGGHVSE 59
           MKRSL SSD SLGALMSICP+ +E SPRN+  VYSREFQ+MLDGLDEEGC+EE+GGHV+E
Sbjct: 1   MKRSLGSSD-SLGALMSICPSAEEHSPRNHTHVYSREFQSMLDGLDEEGCVEEAGGHVTE 59

Query: 60  KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLER 119
           KKRRLS DQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLER
Sbjct: 60  KKRRLSGDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLER 119

Query: 120 DYGVLKANYDALKLNYDSLQHDNEALLKE-----TIVHETDHQNKATLDRD---QESDDK 171
           DYGVLKANYD+LK N+D+LQHDNEALLKE       ++E + ++  ++  +    ES+DK
Sbjct: 120 DYGVLKANYDSLKHNFDALQHDNEALLKEIRELKAKLNEENAESNVSVKEEIILAESEDK 179

Query: 172 QAAAVAPPTNVTAISLAPAGNISDEPDQELNYD--------NGVLGISLFPDLKDGSSDS 223
                 P         A   +++    +ELNY+        N  LG SLFPD KDGSSDS
Sbjct: 180 MPEEDTP---------ALLDSVAASETKELNYETFNNHSSINIGLGASLFPDFKDGSSDS 230

Query: 224 DSSAILNNEDN 234
           DSSAIL NEDN
Sbjct: 231 DSSAIL-NEDN 240

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359480491|ref|XP_003632476.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147785120|emb|CAN62215.1| hypothetical protein VITISV_008512 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741835|emb|CBI33148.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511080|ref|XP_003524258.1| PREDICTED: homeobox-leucine zipper protein ATHB-16-like, partial [Glycine max] Back     alignment and taxonomy information
>gi|449451407|ref|XP_004143453.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis sativus] gi|449533808|ref|XP_004173863.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|4433048|dbj|BAA21017.1| DNA-binding protein [Daucus carota] Back     alignment and taxonomy information
>gi|49659431|dbj|BAD27254.1| SlHDL1 [Silene latifolia] Back     alignment and taxonomy information
>gi|356567620|ref|XP_003552015.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Glycine max] Back     alignment and taxonomy information
>gi|356540251|ref|XP_003538603.1| PREDICTED: homeobox-leucine zipper protein ATHB-6-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2041283311 HB6 "homeobox protein 6" [Arab 0.674 0.684 0.517 1.6e-47
TAIR|locus:2140055294 HB16 "homeobox protein 16" [Ar 0.636 0.683 0.477 3.6e-41
TAIR|locus:2168225312 HB5 "homeobox protein 5" [Arab 0.462 0.467 0.594 9.9e-39
TAIR|locus:2205075294 ATHB13 [Arabidopsis thaliana ( 0.436 0.469 0.503 8.8e-31
TAIR|locus:2084228272 HB-1 "homeobox 1" [Arabidopsis 0.284 0.330 0.722 8.8e-31
TAIR|locus:2150901314 HB-3 "homeobox 3" [Arabidopsis 0.344 0.347 0.572 3.4e-29
TAIR|locus:2102107286 HB20 "homeobox protein 20" [Ar 0.354 0.391 0.539 5e-28
TAIR|locus:2062754258 HB-7 "homeobox 7" [Arabidopsis 0.487 0.596 0.388 5.2e-26
TAIR|locus:2202795255 AtHB23 "homeobox protein 23" [ 0.281 0.349 0.595 1.2e-24
TAIR|locus:2079542235 HB-12 "homeobox 12" [Arabidops 0.287 0.387 0.527 6.8e-24
TAIR|locus:2041283 HB6 "homeobox protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 497 (180.0 bits), Expect = 1.6e-47, P = 1.6e-47
 Identities = 116/224 (51%), Positives = 142/224 (63%)

Query:     1 MKRSLCSSDDSLGALMSICP--ATDEQSPRNNQVYSREFQTMXXXXXXXXXXXXXXX-HV 57
             MKR   SS DS+G L+S+CP  +TDEQSPR  +   REFQ+M                HV
Sbjct:     2 MKR--LSSSDSVGGLISLCPTTSTDEQSPR--RYGGREFQSMLEGYEEEEEAIVEERGHV 57

Query:    58 --SEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTK 115
               SEKKRRLS++QVKALEKNFE+ENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTK
Sbjct:    58 GLSEKKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTK 117

Query:   116 QLERDYGVLKANYDALKLNYDSLQHDNEALLKETIVHETDHQNKATLDRDQESDDKQXXX 175
             QLE+DYGVLK  YD+L+ N+DSL+ DNE+LL+E    +T        + ++E++      
Sbjct:   118 QLEKDYGVLKTQYDSLRHNFDSLRRDNESLLQEISKLKTKLNGGGGEEEEEENNAAVTTE 177

Query:   176 XXXXXXXXXISLAPA-GNISDEPDQELNYDNGVLGISLFPDLKD 218
                      +SL          P Q L + +G L    F DL+D
Sbjct:   178 SDISVKEEEVSLPEKITEAPSSPPQFLEHSDG-LNYRSFTDLRD 220
GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;TAS
GO:0005634 "nucleus" evidence=ISM;IEA;ISS;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0009414 "response to water deprivation" evidence=IEP
GO:0005515 "protein binding" evidence=IPI
GO:0009738 "abscisic acid mediated signaling pathway" evidence=TAS
GO:0009788 "negative regulation of abscisic acid mediated signaling pathway" evidence=IMP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0009269 "response to desiccation" evidence=RCA
GO:0009409 "response to cold" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0009737 "response to abscisic acid stimulus" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2140055 HB16 "homeobox protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168225 HB5 "homeobox protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205075 ATHB13 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084228 HB-1 "homeobox 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150901 HB-3 "homeobox 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102107 HB20 "homeobox protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062754 HB-7 "homeobox 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202795 AtHB23 "homeobox protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079542 HB-12 "homeobox 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q940J1ATB16_ARATHNo assigned EC number0.51800.68030.7312yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.VII.1686.1
Putative uncharacterized protein (296 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-18
smart0038957 smart00389, HOX, Homeodomain 4e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 7e-17
pfam0218345 pfam02183, HALZ, Homeobox associated leucine zippe 9e-12
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-08
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 76.0 bits (188), Expect = 5e-18
 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%)

Query: 60  KKRR--LSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 113
           +++R   + +Q++ LEK FE       E + +LA++LGL  RQV VWFQNRRA+WK
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWK 56

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|202143 pfam02183, HALZ, Homeobox associated leucine zipper Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.82
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.66
KOG0489261 consensus Transcription factor zerknullt and relat 99.63
KOG0488309 consensus Transcription factor BarH and related HO 99.63
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.59
KOG0843197 consensus Transcription factor EMX1 and related HO 99.58
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.56
KOG0850245 consensus Transcription factor DLX and related pro 99.56
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.55
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.55
KOG0493342 consensus Transcription factor Engrailed, contains 99.51
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.49
KOG0848317 consensus Transcription factor Caudal, contains HO 99.49
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.46
KOG0494332 consensus Transcription factor CHX10 and related H 99.46
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.4
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.4
COG5576156 Homeodomain-containing transcription factor [Trans 99.38
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.37
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.32
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.24
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.23
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.23
KOG0847288 consensus Transcription factor, contains HOX domai 99.22
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.21
KOG0490235 consensus Transcription factor, contains HOX domai 99.05
KOG0849354 consensus Transcription factor PRD and related pro 98.81
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.8
KOG0775304 consensus Transcription factor SIX and related HOX 98.61
KOG0774334 consensus Transcription factor PBX and related HOX 98.04
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.02
KOG0490235 consensus Transcription factor, contains HOX domai 97.76
KOG2252558 consensus CCAAT displacement protein and related h 97.64
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 97.38
KOG1146 1406 consensus Homeobox protein [General function predi 97.17
KOG0773342 consensus Transcription factor MEIS1 and related H 95.99
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.19
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 91.59
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 90.02
PRK09413121 IS2 repressor TnpA; Reviewed 84.99
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information 
Probab=99.82  E-value=8.1e-21  Score=172.23  Aligned_cols=105  Identities=59%  Similarity=0.873  Sum_probs=94.7

Q ss_pred             CCCCCCCCCcCCHHHHHHHHHhhhhcCCCCHHHHHHHHHHhCCCccceeeechhhHhhhhhHHHHHHHHHHHhhhHHHhh
Q 021194           54 GGHVSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGVLKANYDALKL  133 (316)
Q Consensus        54 ~g~~krkRrRfT~~Ql~~LE~~F~~~~yPs~~~r~~LA~~LgLs~rQVqVWFQNRRaK~Kkkq~~~~~~~lk~~~~~L~~  133 (316)
                      +....+|++||+.+|+..||..|+.+.++.+.+|..||++|||.+|||+|||||||||||.++++.++..||..++.|+.
T Consensus        47 ~~~~~~kk~Rlt~eQ~~~LE~~F~~~~~L~p~~K~~LAk~LgL~pRQVavWFQNRRARwK~kqlE~d~~~Lk~~~~~l~~  126 (198)
T KOG0483|consen   47 GSKGKGKKRRLTSEQVKFLEKSFESEKKLEPERKKKLAKELGLQPRQVAVWFQNRRARWKTKQLEKDYESLKRQLESLRS  126 (198)
T ss_pred             ccccccccccccHHHHHHhHHhhccccccChHHHHHHHHhhCCChhHHHHHHhhccccccchhhhhhHHHHHHHHHHHhh
Confidence            34456778889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhchHHHHHHHHHhhcccccchhhhhhccc
Q 021194          134 NYDSLQHDNEALLKETIVHETDHQNKATLDR  164 (316)
Q Consensus       134 ~~~sl~~en~~L~~e~~~~~~d~~lk~~L~~  164 (316)
                      +++.++.++..|..++.      .++.+...
T Consensus       127 ~~~~Lq~e~~eL~~~~~------~~~~~~~~  151 (198)
T KOG0483|consen  127 ENDRLQSEVQELVAELS------SLKREMQK  151 (198)
T ss_pred             hhhHHHHHHHHHHHHHh------hhhhhhcc
Confidence            99999999888888887      55554443

>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 1e-07
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 1e-05
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 2e-05
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 2e-05
1hom_A68 Determination Of The Three-Dimensional Structure Of 2e-05
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 4e-05
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 4e-05
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 2e-04
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 3e-04
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 4e-04
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 5e-04
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 7e-04
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 8e-04
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 32/51 (62%)
Query: 63  RLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 113
           R S DQ   LEK FE +  L P  + +LA+ L L  RQV  WFQNRRA+W+
Sbjct: 13  RFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWR 63
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-29
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-17
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 1e-14
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-14
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-13
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-13
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-13
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-13
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-13
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 4e-13
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-13
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 1e-12
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-12
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-12
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-12
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-12
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-12
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 3e-12
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-12
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-12
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-12
3a01_A93 Homeodomain-containing protein; homeodomain, prote 4e-12
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 4e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-12
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 5e-12
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 9e-12
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-11
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-11
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 2e-11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-11
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-11
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-11
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-11
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-10
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-10
1uhs_A72 HOP, homeodomain only protein; structural genomics 4e-10
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 6e-10
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 6e-10
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 7e-10
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 8e-10
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 8e-10
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 9e-10
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-08
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 4e-08
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 4e-08
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 5e-08
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 6e-08
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 6e-08
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-07
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-07
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 9e-07
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-06
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 1e-05
2e19_A64 Transcription factor 8; homeobox domain, structura 4e-05
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 5e-05
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 2e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 7e-04
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
 Score =  105 bits (265), Expect = 3e-29
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 58  SEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 113
            + K  +S      LE+ F  +  L  + K ++A++ G+ P QV VWF N+R R K
Sbjct: 6   PKGKSSISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK 61
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.73
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.73
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.73
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.72
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.72
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.72
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.72
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.72
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.72
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.71
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.71
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.71
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.71
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.71
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.7
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.7
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.7
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.7
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.7
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.7
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.7
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.69
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.69
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.69
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.69
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.69
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.68
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.68
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.68
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.68
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.68
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.68
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.68
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.68
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.68
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.68
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.68
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.68
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.68
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.67
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.67
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.66
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.66
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.66
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.66
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.66
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.65
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.65
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.64
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.64
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.64
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.63
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.63
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.63
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.63
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.62
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.62
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.62
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.61
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.59
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.58
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.58
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.58
2e19_A64 Transcription factor 8; homeobox domain, structura 99.58
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.57
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.57
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.56
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.54
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.54
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.52
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.51
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.51
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.31
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.31
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.29
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.19
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.15
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.76
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 91.47
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 81.06
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
Probab=99.73  E-value=1.4e-18  Score=128.09  Aligned_cols=61  Identities=30%  Similarity=0.413  Sum_probs=53.2

Q ss_pred             CCCCCCCcCCHHHHHHHHHhhhhcCCCCHHHHHHHHHHhCCCccceeeechhhHhhhhhHH
Q 021194           56 HVSEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQ  116 (316)
Q Consensus        56 ~~krkRrRfT~~Ql~~LE~~F~~~~yPs~~~r~~LA~~LgLs~rQVqVWFQNRRaK~Kkkq  116 (316)
                      ..+++|+.||..|+..||..|..++||+..++.+||..+||+++||++||||||+|+|+++
T Consensus         2 ~~rr~Rt~ft~~q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~~WFqNrR~k~kr~q   62 (62)
T 2vi6_A            2 TKQKMRTVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ   62 (62)
T ss_dssp             ------CCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHHTCCHHHHHHHHHHHHHTCGGGC
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCHHHhhHHhHHhhcchhhcC
Confidence            3456677799999999999999999999999999999999999999999999999999863
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-17
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-17
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 4e-17
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 7e-17
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 8e-17
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 4e-16
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 6e-16
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 8e-16
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-15
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-15
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-15
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 6e-15
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 8e-15
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 9e-15
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-14
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 5e-14
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 7e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 8e-14
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 9e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 9e-14
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 1e-13
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-13
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-12
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 3e-12
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 4e-12
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-12
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 7e-12
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-09
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-08
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein prh
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 72.2 bits (177), Expect = 3e-17
 Identities = 26/54 (48%), Positives = 33/54 (61%)

Query: 60  KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 113
            + R S DQ   LEK FE +  L P  + +LA+ L L  RQV  WFQNRRA+W+
Sbjct: 3   GQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWR 56
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.76
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.76
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.76
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.75
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.75
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.75
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.74
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.73
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.73
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.72
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.72
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.71
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.7
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.7
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.7
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.68
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.68
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.68
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.67
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.67
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.65
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.65
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.62
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.62
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.6
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.57
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.57
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.54
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.5
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.5
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.42
d1hlva166 DNA-binding domain of centromere binding protein B 86.47
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein prh
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.76  E-value=1.3e-19  Score=131.36  Aligned_cols=57  Identities=46%  Similarity=0.758  Sum_probs=54.3

Q ss_pred             CCCCCcCCHHHHHHHHHhhhhcCCCCHHHHHHHHHHhCCCccceeeechhhHhhhhh
Q 021194           58 SEKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKT  114 (316)
Q Consensus        58 krkRrRfT~~Ql~~LE~~F~~~~yPs~~~r~~LA~~LgLs~rQVqVWFQNRRaK~Kk  114 (316)
                      |+.|++||.+|+.+||..|+.++||+..++.+||..|||+++||+|||||||+++|+
T Consensus         1 k~~R~~ft~~Q~~~Le~~F~~n~yp~~~~r~~LA~~l~L~~~qV~~WFqNrR~k~kk   57 (57)
T d2e1oa1           1 KGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR   57 (57)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCccCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCHHHhhHhhhhhhhhccC
Confidence            456788999999999999999999999999999999999999999999999999986
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure