Citrus Sinensis ID: 021200


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MHLISELRTKQKEIDGLKSLIYECSEDKDMLDMATEELCLAIDEEKRLQSLLLKSLLPKDDADERDCILEVRAGTGGEEASLFAVDVFKMYERYSQKKGWKFEVVGVTESDLRGYKEASAAISGVGVYGKLKFESGIHRVQRVPLTEKSGRVHTSAVSVAILPQADEVDVRLRNEDLRIDTYRSGGSGGQHANTTNSAVRVTHIPTGMTISIQDERSQHMNKAKALKVLCAKLYEMERSRIHLSRSKLRSEQIGSGDRSERIRTYNFPQGRVTDHRVGITHHAISDMMEGENLDIFIDALLLQQEMDAIASFGSTQ
cHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEEEECcccccccccccccccccccccccccccccccccEEEEccccccccccccccccEEEEEEcccccccccccccccEEcccccccEEEEEcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHccccc
*HLISELRTKQKEIDGLKSLIYECSEDKDMLDMATEELCLAIDEEKRLQSLLLKSLLPKDDADERDCILEVRAGTGGEEASLFAVDVFKMYERYSQKKGWKFEVVGVTESDLRGYKEASAAISGVGVYGKLKFESGIHRVQRVPLTEKSGRVHTSAVSVAILPQADEVDVRLRNEDLRIDTYRSGGSGGQHANTTNSAVRVTHIPTGMTISIQDE*****NKAKALKVLCAKLYEM**********************SERIRTYNFPQGRVTDHRVGITHHAISDMMEGENLDIFIDALLLQQEMD**A******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHLISELRTKQKEIDGLKSLIYECSEDKDMLDMATEELCLAIDEEKRLQSLLLKSLLPKDDADERDCILEVRAGTGGEEASLFAVDVFKMYERYSQKKGWKFEVVGVTESDLRGYKEASAAISGVGVYGKLKFESGIHRVQRVPLTEKSGRVHTSAVSVAILPQADEVDVRLRNEDLRIDTYRSGGSGGQHANTTNSAVRVTHIPTGMTISIQDERSQHMNKAKALKVLCAKLYEMERSRIHLSRSKLRSEQIGSGDRSERIRTYNFPQGRVTDHRVGITHHAISDMMEGENLDIFIDALLLQQEMDAIASFGSTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.probableA8GXI1
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.probableQ98G93
Peptide chain release factor 1 Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.probableQ2RWE1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZBT, chain A
Confidence level:very confident
Coverage over the Query: 1-313
View the alignment between query and template
View the model in PyMOL