Citrus Sinensis ID: 021240
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 315 | ||||||
| 224147350 | 405 | predicted protein [Populus trichocarpa] | 0.984 | 0.765 | 0.720 | 1e-123 | |
| 224080640 | 405 | predicted protein [Populus trichocarpa] | 0.984 | 0.765 | 0.717 | 1e-123 | |
| 359475016 | 409 | PREDICTED: LOW QUALITY PROTEIN: 3-hydrox | 0.984 | 0.757 | 0.650 | 1e-115 | |
| 388492786 | 416 | unknown [Lotus japonicus] | 0.990 | 0.75 | 0.618 | 1e-111 | |
| 449507022 | 409 | PREDICTED: FAD-dependent urate hydroxyla | 0.987 | 0.760 | 0.610 | 1e-109 | |
| 356536384 | 412 | PREDICTED: 6-hydroxynicotinate 3-monooxy | 0.974 | 0.745 | 0.614 | 1e-108 | |
| 356575446 | 412 | PREDICTED: 3-hydroxybenzoate 6-hydroxyla | 0.984 | 0.752 | 0.607 | 1e-108 | |
| 449454358 | 409 | PREDICTED: FAD-dependent urate hydroxyla | 0.987 | 0.760 | 0.603 | 1e-107 | |
| 449454225 | 482 | PREDICTED: FAD-dependent urate hydroxyla | 0.987 | 0.645 | 0.597 | 1e-105 | |
| 15239070 | 406 | FAD/NAD(P)-binding oxidoreductase family | 0.977 | 0.758 | 0.576 | 1e-104 |
| >gi|224147350|ref|XP_002336457.1| predicted protein [Populus trichocarpa] gi|222835068|gb|EEE73517.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 448 bits (1152), Expect = e-123, Method: Compositional matrix adjust.
Identities = 224/311 (72%), Positives = 258/311 (82%), Gaps = 1/311 (0%)
Query: 4 GEHEMRCVRRKLLLETLAKELPSGTIRYSSQVVSIEESGHFKLLHLADGTILKTKVLIGC 63
G+HE+RCVRRKLLLE L KELP GTIRYSS+VVSIEESG+ KL+HLAD TI+KTKVLIGC
Sbjct: 93 GDHEVRCVRRKLLLEALEKELPDGTIRYSSKVVSIEESGYLKLVHLADDTIIKTKVLIGC 152
Query: 64 DGVNSIVAKWLGFKNPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTI 123
DGVNS+VA+++GFK PAF GRSAIRGY+DFK +HGF FL FGKG+RSGF+PCDD TI
Sbjct: 153 DGVNSVVARFIGFKKPAFAGRSAIRGYADFKVNHGFGSKFLLLFGKGVRSGFLPCDDTTI 212
Query: 124 YWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLPAQVKAVIEKTPLDSIISSRLQYRQPQ 183
YWFFT+ + QDKELED+ E+KQFVL KL ++P + +E T LDSI SS L++R P
Sbjct: 213 YWFFTYIPTGQDKELEDNPTEMKQFVLSKLGNVPDHARTSVEITELDSITSSPLRFRHPW 272
Query: 184 EVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGV-GEEDE 242
EVLWGNIS+G+V VAGDALHPMTPDIGQGGCAALEDG+VLARC+ EALK + V G+E E
Sbjct: 273 EVLWGNISKGNVSVAGDALHPMTPDIGQGGCAALEDGVVLARCLAEALKKELNVEGKEKE 332
Query: 243 EEFNKRVEMGLKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGLLL 302
E KRVEMGLK+YA ERRWR FELIS AY+VG+IQQ DGKI+N LRD LA FL GLLL
Sbjct: 333 REEYKRVEMGLKKYAAERRWRSFELISTAYIVGAIQQGDGKIMNILRDAFLAKFLAGLLL 392
Query: 303 KKADFDCGNLT 313
KKADFDCG L
Sbjct: 393 KKADFDCGKLN 403
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224080640|ref|XP_002306191.1| predicted protein [Populus trichocarpa] gi|222849155|gb|EEE86702.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359475016|ref|XP_003631569.1| PREDICTED: LOW QUALITY PROTEIN: 3-hydroxybenzoate 6-hydroxylase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388492786|gb|AFK34459.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449507022|ref|XP_004162912.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356536384|ref|XP_003536718.1| PREDICTED: 6-hydroxynicotinate 3-monooxygenase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356575446|ref|XP_003555852.1| PREDICTED: 3-hydroxybenzoate 6-hydroxylase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449454358|ref|XP_004144922.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449454225|ref|XP_004144856.1| PREDICTED: FAD-dependent urate hydroxylase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15239070|ref|NP_196151.1| FAD/NAD(P)-binding oxidoreductase family protein [Arabidopsis thaliana] gi|10176744|dbj|BAB09975.1| monooxygenase [Arabidopsis thaliana] gi|27808600|gb|AAO24580.1| At5g05320 [Arabidopsis thaliana] gi|110743614|dbj|BAE99644.1| monooxygenase [Arabidopsis thaliana] gi|332003474|gb|AED90857.1| FAD/NAD(P)-binding oxidoreductase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 315 | ||||||
| TAIR|locus:2121254 | 407 | AT4G38540 "AT4G38540" [Arabido | 0.977 | 0.756 | 0.615 | 3e-101 | |
| TAIR|locus:2153499 | 406 | AT5G05320 "AT5G05320" [Arabido | 0.977 | 0.758 | 0.580 | 9.4e-98 | |
| TAIR|locus:2058723 | 439 | CTF2A "AT2G35660" [Arabidopsis | 0.911 | 0.653 | 0.367 | 9.1e-45 | |
| TAIR|locus:2130694 | 422 | MO1 "monooxygenase 1" [Arabido | 0.952 | 0.710 | 0.358 | 1.2e-44 | |
| TAIR|locus:2060584 | 427 | CTF2B "AT2G29720" [Arabidopsis | 0.879 | 0.648 | 0.375 | 5e-44 | |
| TAIR|locus:504955430 | 271 | AT4G15765 "AT4G15765" [Arabido | 0.631 | 0.734 | 0.305 | 3.3e-24 | |
| UNIPROTKB|P86491 | 385 | P86491 "6-hydroxynicotinate 3- | 0.628 | 0.514 | 0.298 | 5.2e-14 | |
| UNIPROTKB|Q88FY2 | 382 | nicC "6-hydroxynicotinate 3-mo | 0.615 | 0.507 | 0.308 | 8.8e-13 | |
| UNIPROTKB|A6T923 | 384 | hpxO "FAD-dependent urate hydr | 0.809 | 0.664 | 0.254 | 3.5e-12 | |
| TAIR|locus:2158083 | 667 | ABA1 "ABA DEFICIENT 1" [Arabid | 0.746 | 0.352 | 0.285 | 3.8e-12 |
| TAIR|locus:2121254 AT4G38540 "AT4G38540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1004 (358.5 bits), Expect = 3.0e-101, P = 3.0e-101
Identities = 192/312 (61%), Positives = 240/312 (76%)
Query: 3 SGEHEMRCVRRKLLLETLAKELPSGTIRYSSQVVSIEESGHFKLLHLADGTILKTKVLIG 62
S E+E RCV+RKLLLE LA ELP TIR+SS+VV IE SG +K +HL+DGTILKTKVL+G
Sbjct: 96 SEEYESRCVQRKLLLEALAGELPEETIRFSSKVVHIELSGCYKKVHLSDGTILKTKVLVG 155
Query: 63 CDGVNSIVAKWLGFKNPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQT 122
CDGV S+V KWLGFKNPA R AIRG + F HGF F QF+G G+RSGFIPCD T
Sbjct: 156 CDGVYSVVGKWLGFKNPATTARLAIRGLTHFPEGHGFGKRFFQFYGDGVRSGFIPCDHNT 215
Query: 123 IYWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLPAQVKAVIEKTPLDSIISSRLQYRQP 182
+YWF T TS+ D+E +S LK+FVL K+ DLP +K V+E T LDS++ S+L+YR P
Sbjct: 216 VYWFLTHTSTDIDEET--NSEILKEFVLNKIKDLPENIKNVVETTDLDSMVMSQLKYRPP 273
Query: 183 QEVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTK--QGVGEE 240
E+LW NI++ +VCVAGDALHPMTPDIGQGGC+A+EDG++LARC+ EA+K K +G EE
Sbjct: 274 WELLWSNITKDNVCVAGDALHPMTPDIGQGGCSAMEDGVILARCLGEAIKAKSLKGETEE 333
Query: 241 DEEEFNKRVEMGLKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGL 300
+EEE KR+E GLK+YA ER+WR +LI+ AY VG IQQS GK +N RD+ L+S+L +
Sbjct: 334 NEEEGYKRIEEGLKKYAGERKWRSIDLITTAYTVGFIQQSRGKWMNMFRDRFLSSYLSRM 393
Query: 301 LLKKADFDCGNL 312
LLKK+ FDCG+L
Sbjct: 394 LLKKSHFDCGSL 405
|
|
| TAIR|locus:2153499 AT5G05320 "AT5G05320" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2058723 CTF2A "AT2G35660" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130694 MO1 "monooxygenase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2060584 CTF2B "AT2G29720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955430 AT4G15765 "AT4G15765" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P86491 P86491 "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas fluorescens (taxid:294)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q88FY2 nicC "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas putida KT2440 (taxid:160488)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6T923 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (taxid:272620)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158083 ABA1 "ABA DEFICIENT 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_scaffold_4047000001 | hypothetical protein (405 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| estExt_fgenesh4_pg.C_LG_XVIII0354 | • | 0.447 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 315 | |||
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 5e-28 | |
| PRK06753 | 373 | PRK06753, PRK06753, hypothetical protein; Provisio | 8e-28 | |
| PRK06847 | 375 | PRK06847, PRK06847, hypothetical protein; Provisio | 6e-20 | |
| PLN02927 | 668 | PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa | 5e-15 | |
| PRK06126 | 545 | PRK06126, PRK06126, hypothetical protein; Provisio | 1e-10 | |
| pfam01494 | 349 | pfam01494, FAD_binding_3, FAD binding domain | 3e-10 | |
| PRK07538 | 413 | PRK07538, PRK07538, hypothetical protein; Provisio | 3e-06 | |
| PRK07045 | 388 | PRK07045, PRK07045, putative monooxygenase; Review | 4e-06 | |
| PRK08163 | 396 | PRK08163, PRK08163, salicylate hydroxylase; Provis | 6e-06 | |
| COG0644 | 396 | COG0644, FixC, Dehydrogenases (flavoproteins) [Ene | 1e-05 | |
| TIGR01988 | 387 | TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd | 2e-05 | |
| PRK06183 | 500 | PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr | 2e-05 | |
| TIGR01989 | 437 | TIGR01989, COQ6, ubiquinone biosynthesis monooxyge | 3e-05 | |
| TIGR03219 | 414 | TIGR03219, salicylate_mono, salicylate 1-monooxyge | 8e-05 | |
| PRK08163 | 396 | PRK08163, PRK08163, salicylate hydroxylase; Provis | 1e-04 | |
| PRK07333 | 403 | PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h | 9e-04 | |
| TIGR02032 | 295 | TIGR02032, GG-red-SF, geranylgeranyl reductase fam | 0.001 | |
| PRK07236 | 386 | PRK07236, PRK07236, hypothetical protein; Provisio | 0.002 |
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
Score = 111 bits (279), Expect = 5e-28
Identities = 73/315 (23%), Positives = 115/315 (36%), Gaps = 40/315 (12%)
Query: 2 FSGEHEMRCVRRKLLLETL---AKELPSGTIRYSSQVVSIEESGHFKLLHLA-DGTILKT 57
V R LL L A+ LP+ T+R+ ++V ++E+ G + L+ DG L
Sbjct: 92 LGRGALGYVVPRSDLLNALLEAARALPNVTLRFGAEVEAVEQDGDGVTVTLSFDGETLDA 151
Query: 58 KVLIGCDGVNSIVAKWLG----FKNPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRS 113
+L+G DG NS V + G G++A+ + + E + F
Sbjct: 152 DLLVGADGANSAVRRAAGIAEFSGRDY--GQTALVA--NVEPEEPHEGRAGERFTHAGPF 207
Query: 114 GFIPCDDQTIYWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLPAQV---KAVIEKTPLD 170
+P D + S + L L +L ++ + T +
Sbjct: 208 ALLPLPDNRSSVVW-----SLPPGPAEDLQGLSDEEF--LRELQRRLGERDPLGRVTLVS 260
Query: 171 SIISSRLQYRQPQEVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEA 230
S + L R + RG V + GDA H M P GQG ALED LA + A
Sbjct: 261 SRSAFPLSLRVAER-----YRRGRVVLIGDAAHAMHPLAGQGANLALEDAAALAEALAAA 315
Query: 231 LKTKQGVGEEDEEEFNKRVEMGLKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRD 290
+ D L Y RR R + ++ +G + +DG FLR+
Sbjct: 316 PR-----PGADAA--------ALAAYEARRRPRAEAIQKLSRALGRLFSADGPFARFLRN 362
Query: 291 KILASFLVGLLLKKA 305
L L++A
Sbjct: 363 LGLRLLDRLPPLREA 377
|
Length = 387 |
| >gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233672 TIGR01989, COQ6, ubiquinone biosynthesis monooxygenase COQ6 | Back alignment and domain information |
|---|
| >gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 315 | |||
| PRK06753 | 373 | hypothetical protein; Provisional | 100.0 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 100.0 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 100.0 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 100.0 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 100.0 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 100.0 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 100.0 | |
| PRK05868 | 372 | hypothetical protein; Validated | 100.0 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 100.0 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 100.0 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 100.0 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 100.0 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 100.0 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 100.0 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 100.0 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 100.0 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 100.0 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 100.0 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 100.0 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 100.0 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 100.0 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 100.0 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 100.0 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 100.0 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 100.0 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 100.0 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 100.0 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 100.0 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 100.0 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 100.0 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 100.0 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 100.0 | |
| PLN02985 | 514 | squalene monooxygenase | 100.0 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 100.0 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 100.0 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 99.98 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 99.98 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 99.98 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 99.98 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 99.97 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 99.97 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 99.97 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 99.97 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 99.97 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 99.93 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 99.93 | |
| PF08491 | 276 | SE: Squalene epoxidase; InterPro: IPR013698 This d | 99.93 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 99.92 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 99.92 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 99.92 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 99.92 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 99.88 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 99.88 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 99.86 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 99.86 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 99.86 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 99.85 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 99.77 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 99.75 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 99.75 | |
| PLN02463 | 447 | lycopene beta cyclase | 99.72 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 99.51 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 97.96 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 97.89 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 97.81 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 97.79 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 97.73 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 97.68 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 97.67 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 97.61 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 97.56 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 97.5 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 97.5 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 97.45 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 97.45 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 97.37 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 97.26 | |
| PLN02612 | 567 | phytoene desaturase | 97.22 | |
| PLN02676 | 487 | polyamine oxidase | 97.16 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 97.15 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 97.13 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 97.01 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 96.83 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 96.8 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 96.8 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 96.7 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 96.61 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 96.56 | |
| PLN02268 | 435 | probable polyamine oxidase | 96.42 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 96.41 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 96.38 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 96.0 | |
| PLN02976 | 1713 | amine oxidase | 95.94 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 95.85 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 95.59 | |
| PLN02568 | 539 | polyamine oxidase | 95.54 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 95.46 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 95.43 | |
| PLN03000 | 881 | amine oxidase | 95.4 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 95.28 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 95.2 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 95.17 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 95.15 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 94.97 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 94.86 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 94.86 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 94.79 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 94.75 | |
| PLN02487 | 569 | zeta-carotene desaturase | 94.56 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 94.53 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 94.3 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 94.12 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 94.05 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 93.76 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 93.73 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 93.46 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 93.35 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 92.99 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 92.68 | |
| PRK06116 | 450 | glutathione reductase; Validated | 92.68 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 92.16 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 91.9 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 91.83 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 91.53 | |
| PLN02507 | 499 | glutathione reductase | 91.26 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 91.18 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 90.88 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 90.87 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 90.75 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 90.62 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 90.55 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 90.39 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 90.3 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 90.21 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 90.11 | |
| TIGR03377 | 516 | glycerol3P_GlpA glycerol-3-phosphate dehydrogenase | 90.02 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 89.86 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 89.54 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 89.27 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 87.85 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 87.69 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 87.39 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 87.33 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 87.3 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 87.27 | |
| KOG1346 | 659 | consensus Programmed cell death 8 (apoptosis-induc | 87.06 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 86.92 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 86.83 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 86.27 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 86.26 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 86.23 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 85.96 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 85.63 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 85.33 | |
| KOG1336 | 478 | consensus Monodehydroascorbate/ferredoxin reductas | 85.12 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 84.89 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 84.82 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 84.46 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 84.44 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 84.39 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 84.27 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 84.23 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 84.07 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 83.93 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 83.61 | |
| PRK06370 | 463 | mercuric reductase; Validated | 83.58 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 83.51 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 82.94 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 82.86 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 82.69 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 82.33 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 82.24 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 81.86 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 81.83 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 81.82 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 81.65 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 81.63 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 81.04 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 80.58 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 80.36 |
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.9e-37 Score=275.96 Aligned_cols=271 Identities=25% Similarity=0.415 Sum_probs=210.2
Q ss_pred ccceeeeHHHHHHHHHhhCCCCcEEecceEEEEEeeCCeeEEEecCCCEEeecEEEecCCCchhhhhhhCCC-CCccccc
Q 021240 6 HEMRCVRRKLLLETLAKELPSGTIRYSSQVVSIEESGHFKLLHLADGTILKTKVLIGCDGVNSIVAKWLGFK-NPAFVGR 84 (315)
Q Consensus 6 ~~~~~i~R~~L~~~L~~~~~~~~i~~~~~v~~~~~~~~~~~v~~~~g~~~~ad~vVgADG~~S~vr~~l~~~-~~~~~~~ 84 (315)
...+.++|..|.+.|.+++++.+|++|++|++++.++++++|++++|+++++|+||||||.+|.||+.++.. ...+.+.
T Consensus 90 ~~~~~i~R~~l~~~L~~~~~~~~i~~~~~v~~i~~~~~~v~v~~~~g~~~~~~~vigadG~~S~vR~~~~~~~~~~~~g~ 169 (373)
T PRK06753 90 TLNVTLHRQTLIDIIKSYVKEDAIFTGKEVTKIENETDKVTIHFADGESEAFDLCIGADGIHSKVRQSVNADSKVRYQGY 169 (373)
T ss_pred CccccccHHHHHHHHHHhCCCceEEECCEEEEEEecCCcEEEEECCCCEEecCEEEECCCcchHHHHHhCCCCCceEcce
Confidence 345789999999999999888899999999999988888999999999999999999999999999999654 3455667
Q ss_pred eEEEeeeecCCCCCCCCceEEEecCCeEEEEEecCCCeEEEEEEeeCCCCCcccccChHHHHHHHHHHhcCCChHHHHHH
Q 021240 85 SAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLPAQVKAVI 164 (315)
Q Consensus 85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 164 (315)
.++.+.+...... .......+++.+++++++|..++..+|.+.+..+....... ....+.+.+.+.++.+.++.++
T Consensus 170 ~~~~~~~~~~~~~-~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~~~~~~~~~~~~---~~~~~~l~~~~~~~~~~~~~~~ 245 (373)
T PRK06753 170 TCFRGLIDDIDLK-LPDCAKEYWGTKGRFGIVPLLNNQAYWFITINAKERDPKYS---SFGKPHLQAYFNHYPNEVREIL 245 (373)
T ss_pred EEEEEEecccccc-CccceEEEEcCCCEEEEEEcCCCeEEEEEEeccccCCcccc---cccHHHHHHHHhcCChHHHHHH
Confidence 7777765433211 12233445566667789999999888877664332211111 1123566677778888888888
Q ss_pred HcCCCcceeeccccccCcccccccCcCCCcEEEeccCCCCCCCCCccchhhhhhHHHHHHHHHHHHHhccCCCCCCchhh
Q 021240 165 EKTPLDSIISSRLQYRQPQEVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEEE 244 (315)
Q Consensus 165 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~LiGDAAh~~~P~~G~G~~~al~da~~La~~l~~~~~~~~~~~~~~~~~ 244 (315)
+..........++....+ .++|..+||+|||||||+|+|+.|||+|+||+||..|+++|.. .
T Consensus 246 ~~~~~~~~~~~~~~~~~~----~~~~~~~rv~LiGDAAh~~~P~~GqG~n~ai~Da~~L~~~L~~---~----------- 307 (373)
T PRK06753 246 DKQSETGILHHDIYDLKP----LKSFVYGRIVLLGDAAHATTPNMGQGAGQAMEDAIVLANCLNA---Y----------- 307 (373)
T ss_pred HhCCcccceeeccccccc----cccccCCCEEEEecccccCCCCcCccHHHHHHHHHHHHHHhhh---c-----------
Confidence 765432323333333333 2478999999999999999999999999999999999999953 1
Q ss_pred hhHHHHHHHHHHHHhhhhhHHHHHHHHHHhhhhhccCchHHHHHHHHHHHHHHHhhh
Q 021240 245 FNKRVEMGLKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFLVGLL 301 (315)
Q Consensus 245 s~~~~~~~l~~Y~~~r~~~~~~~~~~s~~~~~~~~~~~~~~~~~r~~~l~~~~~~~~ 301 (315)
+.+++|+.|+++|++++...++.++.+..+++.+.+....+|+..++.......
T Consensus 308 ---~~~~al~~Y~~~r~~~~~~~~~~s~~~~~~~~~~~~~~~~~r~~~l~~~~~~~~ 361 (373)
T PRK06753 308 ---DFEKALQRYDKIRVKHTAKVIKRSRKIGKIAQIESKLLVALRNRVMKRMPNALA 361 (373)
T ss_pred ---cHHHHHHHHHHHhhHHHHHHHHHHHHHhHHHhcCCchHHHHHHHHHHhCChhhh
Confidence 568899999999999999999999999999999898899999999987654443
|
|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 315 | ||||
| 3rp8_A | 407 | Crystal Structure Of Klebsiella Pneumoniae R204q Hp | 7e-13 | ||
| 3rp6_A | 407 | Crystal Structure Of Klebsiella Pneumoniae Hpxo Com | 1e-12 | ||
| 4hb9_A | 412 | Crystal Structure Of A Putative Fad Containing Mono | 1e-07 | ||
| 3all_A | 379 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 7e-06 | ||
| 3alh_A | 379 | Higher Resolution And Native Structure Of 2-Methyl- | 1e-05 | ||
| 3gmc_A | 415 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 1e-05 | ||
| 3alk_A | 379 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 2e-05 | ||
| 3gmb_A | 415 | Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C | 7e-05 |
| >pdb|3RP8|A Chain A, Crystal Structure Of Klebsiella Pneumoniae R204q Hpxo Complexed With Fad Length = 407 | Back alignment and structure |
|
| >pdb|3RP6|A Chain A, Crystal Structure Of Klebsiella Pneumoniae Hpxo Complexed With Fad Length = 407 | Back alignment and structure |
| >pdb|4HB9|A Chain A, Crystal Structure Of A Putative Fad Containing Monooxygenase From Photorhabdus Luminescens Subsp. Laumondii Tto1 (Target Psi-012791) Length = 412 | Back alignment and structure |
| >pdb|3ALL|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270a Length = 379 | Back alignment and structure |
| >pdb|3ALH|A Chain A, Higher Resolution And Native Structure Of 2-Methyl-3-Hydroxypyridine- 5-Carboxylic Acid Oxygenase Length = 379 | Back alignment and structure |
| >pdb|3GMC|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase With Substrate Bound Length = 415 | Back alignment and structure |
| >pdb|3ALK|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270f Length = 379 | Back alignment and structure |
| >pdb|3GMB|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase Length = 415 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 315 | |||
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 8e-54 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 3e-38 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 4e-37 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 8e-33 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 3e-32 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 2e-17 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 7e-15 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 2e-14 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 5e-14 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 3e-12 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 7e-12 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 1e-11 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 1e-11 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 1e-11 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 8e-11 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 8e-10 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 3e-09 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 5e-08 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 1e-07 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-06 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 7e-06 |
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 | Back alignment and structure |
|---|
Score = 180 bits (458), Expect = 8e-54
Identities = 60/292 (20%), Positives = 98/292 (33%), Gaps = 25/292 (8%)
Query: 6 HEMRCVRRKLLLETLAKELPSGTIRYSSQVVSIEESGHFKLLHLADGTILKTKVLIGCDG 65
V R L + ++++ +V EE + DG+ +LI DG
Sbjct: 119 SRPCPVSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADG 178
Query: 66 VNSIVAKWL--GFKNPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTI 123
+S + W+ + G G + + + F G+G + +P
Sbjct: 179 SHSALRPWVLGFTPQRRYAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRF 238
Query: 124 YWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLPAQVKAVIEKTPLDSIISSRLQYRQPQ 183
Y+FF L + L+ + V+ +I + + +P
Sbjct: 239 YFFFDVPL---PAGLAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRIEIHDIEPF 295
Query: 184 EVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEE 243
RG V + GDA H TPDIGQGGCAA+ED +VL + D
Sbjct: 296 SR-L---VRGRVALLGDAGHSTTPDIGQGGCAAMEDAVVLGAVFRQT---------RD-- 340
Query: 244 EFNKRVEMGLKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILAS 295
+ L+ Y +R R +L+ A I L + L
Sbjct: 341 -----IAAALREYEAQRCDRVRDLVLKARKRCDITHGKDMQLTEAWYQELRE 387
|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 315 | |||
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 100.0 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 100.0 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 100.0 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 100.0 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 100.0 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 100.0 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 100.0 | |
| 3fmw_A | 570 | Oxygenase; mithramycin, baeyer-villiger, flavin bi | 99.97 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 99.97 | |
| 1pn0_A | 665 | Phenol 2-monooxygenase; two dimers, TLS refinement | 99.97 | |
| 3ihg_A | 535 | RDME; flavoenzyme, anthracycline, polyketide biosy | 99.97 | |
| 2r0c_A | 549 | REBC; flavin adenine dinucleotide, monooxygenase, | 99.97 | |
| 3c96_A | 410 | Flavin-containing monooxygenase; FAD, oxidoreducta | 99.97 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 99.97 | |
| 2dkh_A | 639 | 3-hydroxybenzoate hydroxylase; flavoprotein, monoo | 99.96 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 99.95 | |
| 3atr_A | 453 | Conserved archaeal protein; saturating double bond | 99.95 | |
| 3oz2_A | 397 | Digeranylgeranylglycerophospholipid reductase; str | 99.95 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 99.95 | |
| 3c4a_A | 381 | Probable tryptophan hydroxylase VIOD; alpha-beta p | 99.94 | |
| 3i3l_A | 591 | Alkylhalidase CMLS; flavin-dependent halogenase, c | 99.94 | |
| 2gmh_A | 584 | Electron transfer flavoprotein-ubiquinone oxidored | 99.92 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 99.91 | |
| 2pyx_A | 526 | Tryptophan halogenase; structural genomics, JOI fo | 99.9 | |
| 2weu_A | 511 | Tryptophan 5-halogenase; regioselectivity, antifun | 99.9 | |
| 2aqj_A | 538 | Tryptophan halogenase, pRNA; flavin-dependent halo | 99.88 | |
| 2e4g_A | 550 | Tryptophan halogenase; flavin-binding, rebeccamyci | 99.88 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 99.82 | |
| 2bry_A | 497 | NEDD9 interacting protein with calponin homology a | 99.57 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 99.35 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 98.61 | |
| 2gag_B | 405 | Heterotetrameric sarcosine oxidase beta-subunit; f | 98.58 | |
| 1y56_B | 382 | Sarcosine oxidase; dehydrogenase, protein-protein | 98.42 | |
| 3nyc_A | 381 | D-arginine dehydrogenase; FAD, imino-arginine, oxi | 98.39 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 98.24 | |
| 2oln_A | 397 | NIKD protein; flavoprotein, rossmann fold, oxidore | 98.2 | |
| 3ps9_A | 676 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.1 | |
| 2qcu_A | 501 | Aerobic glycerol-3-phosphate dehydrogenase; glycer | 98.05 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 98.04 | |
| 3pvc_A | 689 | TRNA 5-methylaminomethyl-2-thiouridine biosynthes | 98.03 | |
| 3dme_A | 369 | Conserved exported protein; structural genomics, P | 97.99 | |
| 3i6d_A | 470 | Protoporphyrinogen oxidase; protein-inhibitor comp | 97.98 | |
| 3dje_A | 438 | Fructosyl amine: oxygen oxidoreductase; fructosyl- | 97.87 | |
| 3axb_A | 448 | Putative oxidoreductase; dinucleotide-binding fold | 97.76 | |
| 3qj4_A | 342 | Renalase; FAD/NAD(P)-binding rossmann fold superfa | 97.61 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 97.61 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 97.6 | |
| 3da1_A | 561 | Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 | 97.54 | |
| 3v76_A | 417 | Flavoprotein; structural genomics, PSI-biology, NE | 97.42 | |
| 2i0z_A | 447 | NAD(FAD)-utilizing dehydrogenases; structural geno | 97.42 | |
| 3c4n_A | 405 | Uncharacterized protein DR_0571; alpha-beta protei | 97.4 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 97.33 | |
| 3ka7_A | 425 | Oxidoreductase; structural genomics, PSI-2, protei | 97.32 | |
| 3nrn_A | 421 | Uncharacterized protein PF1083; alpha-beta protein | 97.28 | |
| 3lov_A | 475 | Protoporphyrinogen oxidase; structural genomics, J | 97.22 | |
| 3nlc_A | 549 | Uncharacterized protein VP0956; FAD-binding protei | 97.09 | |
| 2jae_A | 489 | L-amino acid oxidase; oxidoreductase, dimerisation | 96.84 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 96.8 | |
| 3k7m_X | 431 | 6-hydroxy-L-nicotine oxidase; enantiomeric substra | 96.79 | |
| 2vvm_A | 495 | Monoamine oxidase N; FAD, peroxisome, flavoprotein | 96.75 | |
| 1sez_A | 504 | Protoporphyrinogen oxidase, mitochondrial; FAD-bin | 96.72 | |
| 2ivd_A | 478 | PPO, PPOX, protoporphyrinogen oxidase; porphyrin b | 96.69 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 96.6 | |
| 1rp0_A | 284 | ARA6, thiazole biosynthetic enzyme; protein ligand | 96.59 | |
| 2gqf_A | 401 | Hypothetical protein HI0933; structural genomics, | 96.58 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 96.57 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 96.54 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 96.53 | |
| 4gut_A | 776 | Lysine-specific histone demethylase 1B; histone de | 96.46 | |
| 3ces_A | 651 | MNMG, tRNA uridine 5-carboxymethylaminomethyl modi | 96.22 | |
| 3gwf_A | 540 | Cyclohexanone monooxygenase; flavoprotein biocatal | 96.18 | |
| 2iid_A | 498 | L-amino-acid oxidase; flavoenzyme, FAD binding dom | 96.16 | |
| 2yg5_A | 453 | Putrescine oxidase; oxidoreductase, flavin; HET: F | 96.15 | |
| 1qo8_A | 566 | Flavocytochrome C3 fumarate reductase; oxidoreduct | 96.08 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 95.95 | |
| 3jsk_A | 344 | Cypbp37 protein; octameric thiazole synthase, bios | 95.83 | |
| 1w4x_A | 542 | Phenylacetone monooxygenase; baeyer-villiger, FAD; | 95.81 | |
| 3cp8_A | 641 | TRNA uridine 5-carboxymethylaminomethyl modificati | 95.8 | |
| 2zxi_A | 637 | TRNA uridine 5-carboxymethylaminomethyl modificat | 95.74 | |
| 2z3y_A | 662 | Lysine-specific histone demethylase 1; chromatin, | 95.69 | |
| 2v3a_A | 384 | Rubredoxin reductase; alkane degradation, NADH oxi | 95.69 | |
| 2rgh_A | 571 | Alpha-glycerophosphate oxidase; flavoprotein oxida | 95.62 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 95.47 | |
| 4ap3_A | 549 | Steroid monooxygenase; oxidoreductase, baeyer-vill | 95.42 | |
| 2yqu_A | 455 | 2-oxoglutarate dehydrogenase E3 component; lipoami | 95.39 | |
| 1c0p_A | 363 | D-amino acid oxidase; alpha-beta-alpha motif, flav | 95.37 | |
| 1y0p_A | 571 | Fumarate reductase flavoprotein subunit; flavocyto | 95.35 | |
| 1pj5_A | 830 | N,N-dimethylglycine oxidase; channelling, FAD bind | 95.24 | |
| 1b37_A | 472 | Protein (polyamine oxidase); flavin-dependent amin | 94.98 | |
| 2xve_A | 464 | Flavin-containing monooxygenase; oxidoreductase; H | 94.81 | |
| 1rsg_A | 516 | FMS1 protein; FAD binding motif, oxidoreductase; H | 94.81 | |
| 1ges_A | 450 | Glutathione reductase; oxidoreductase(flavoenzyme) | 94.72 | |
| 1fl2_A | 310 | Alkyl hydroperoxide reductase subunit F; reactive | 94.68 | |
| 3o0h_A | 484 | Glutathione reductase; ssgcid, structur genomics, | 94.65 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 94.6 | |
| 3uox_A | 545 | Otemo; baeyer-villiger monooxygenase, oxidoreducta | 94.58 | |
| 2r9z_A | 463 | Glutathione amide reductase; NAD, FAD, substrate s | 94.47 | |
| 1s3e_A | 520 | Amine oxidase [flavin-containing] B; human monoami | 94.43 | |
| 2eq6_A | 464 | Pyruvate dehydrogenase complex, dihydrolipoamide d | 94.16 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 94.1 | |
| 1d4d_A | 572 | Flavocytochrome C fumarate reductase; oxidoreducta | 94.08 | |
| 2a87_A | 335 | TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL | 93.95 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 93.94 | |
| 3g3e_A | 351 | D-amino-acid oxidase; FAD, flavoprotein, oxidoredu | 93.88 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 93.85 | |
| 3iwa_A | 472 | FAD-dependent pyridine nucleotide-disulphide oxido | 93.77 | |
| 1m6i_A | 493 | Programmed cell death protein 8; apoptosis, AIF, o | 93.68 | |
| 1kf6_A | 602 | Fumarate reductase flavoprotein; respiration, fuma | 93.67 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 93.54 | |
| 1xdi_A | 499 | RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun | 93.53 | |
| 3fg2_P | 404 | Putative rubredoxin reductase; ferredoxin reductas | 93.48 | |
| 3lxd_A | 415 | FAD-dependent pyridine nucleotide-disulphide oxido | 93.41 | |
| 3cty_A | 319 | Thioredoxin reductase; FAD, oxidoreductase, flavin | 93.2 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 93.07 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 93.04 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 92.98 | |
| 2gjc_A | 326 | Thiazole biosynthetic enzyme, mitochondrial; gluta | 92.93 | |
| 2wpf_A | 495 | Trypanothione reductase; oxidoreductase, trypanoso | 92.84 | |
| 2hqm_A | 479 | GR, grase, glutathione reductase; glutathione redu | 92.75 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 92.68 | |
| 1mo9_A | 523 | ORF3; nucleotide binding motifs, nucleotide bindin | 92.61 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 92.54 | |
| 1fec_A | 490 | Trypanothione reductase; redox-active center, oxid | 92.41 | |
| 1ebd_A | 455 | E3BD, dihydrolipoamide dehydrogenase; redox-active | 92.3 | |
| 1onf_A | 500 | GR, grase, glutathione reductase; oxidoreductase; | 92.01 | |
| 2qae_A | 468 | Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin | 92.0 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 91.6 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 91.53 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 91.47 | |
| 3p1w_A | 475 | Rabgdi protein; GDI RAB, malaria, structural genom | 90.81 | |
| 4at0_A | 510 | 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore | 90.71 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 90.71 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 90.69 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 90.29 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 89.89 | |
| 1zmd_A | 474 | Dihydrolipoyl dehydrogenase; lipoamide dehydrogena | 89.84 | |
| 2e5v_A | 472 | L-aspartate oxidase; archaea, oxidoreductase; HET: | 89.83 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 89.82 | |
| 3s5w_A | 463 | L-ornithine 5-monooxygenase; class B flavin depend | 89.79 | |
| 3lad_A | 476 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 89.7 | |
| 1d5t_A | 433 | Guanine nucleotide dissociation inhibitor; ultra-h | 89.49 | |
| 2cdu_A | 452 | NADPH oxidase; flavoenzyme, oxidoreductase; HET: F | 89.41 | |
| 4dna_A | 463 | Probable glutathione reductase; structural genomic | 89.33 | |
| 2gqw_A | 408 | Ferredoxin reductase; flavoprotein, oxidoreductase | 89.05 | |
| 2h88_A | 621 | Succinate dehydrogenase flavoprotein subunit; comp | 88.99 | |
| 2a8x_A | 464 | Dihydrolipoyl dehydrogenase, E3 component of alpha | 88.98 | |
| 2wdq_A | 588 | Succinate dehydrogenase flavoprotein subunit; succ | 88.25 | |
| 1zk7_A | 467 | HGII, reductase, mercuric reductase; mercuric ION | 87.88 | |
| 3l8k_A | 466 | Dihydrolipoyl dehydrogenase; redox-active center, | 87.81 | |
| 3ic9_A | 492 | Dihydrolipoamide dehydrogenase; APC62701, colwelli | 87.78 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 87.62 | |
| 1chu_A | 540 | Protein (L-aspartate oxidase); flavoenzyme, NAD bi | 87.55 | |
| 3dgh_A | 483 | TRXR-1, thioredoxin reductase 1, mitochondrial; ox | 87.31 | |
| 2b9w_A | 424 | Putative aminooxidase; isomerase, conjugated linol | 86.65 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 86.6 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 86.56 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 86.06 | |
| 4b1b_A | 542 | TRXR, thioredoxin reductase; oxidoreductase, FAD, | 85.91 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 85.84 | |
| 1dxl_A | 470 | Dihydrolipoamide dehydrogenase; oxidoreductase, mu | 85.77 | |
| 2bcg_G | 453 | Secretory pathway GDP dissociation inhibitor; RABG | 85.65 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 83.98 | |
| 1q1r_A | 431 | Putidaredoxin reductase; glutathione reductase fol | 83.89 | |
| 1nhp_A | 447 | NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA | 83.87 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 83.73 | |
| 4gde_A | 513 | UDP-galactopyranose mutase; flavin adenine dinucle | 83.28 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 83.09 | |
| 1lvl_A | 458 | Dihydrolipoamide dehydrogenase; oxidoreductase; HE | 83.0 | |
| 3dk9_A | 478 | Grase, GR, glutathione reductase; flavoenzyme, nic | 82.55 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 82.25 | |
| 2bs2_A | 660 | Quinol-fumarate reductase flavoprotein subunit A; | 81.81 | |
| 4dsg_A | 484 | UDP-galactopyranose mutase; rossmann fold, flavin | 81.58 | |
| 1v59_A | 478 | Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog | 81.49 | |
| 1ojt_A | 482 | Surface protein; redox-active center, glycolysis, | 81.42 | |
| 4b63_A | 501 | L-ornithine N5 monooxygenase; oxidoreductase, side | 80.94 | |
| 3vrd_B | 401 | FCCB subunit, flavocytochrome C flavin subunit; su | 80.88 | |
| 1y56_A | 493 | Hypothetical protein PH1363; dehydrogenase, protei | 80.86 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 80.84 | |
| 2q0l_A | 311 | TRXR, thioredoxin reductase; bacterial thiredoxin | 80.19 |
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-37 Score=282.78 Aligned_cols=268 Identities=23% Similarity=0.367 Sum_probs=223.4
Q ss_pred ccceeeeHHHHHHHHHhhCCCCcEEecceEEEEEeeCCeeEEEecCCCEEeecEEEecCCCchhhhhhh-CCC-CCcccc
Q 021240 6 HEMRCVRRKLLLETLAKELPSGTIRYSSQVVSIEESGHFKLLHLADGTILKTKVLIGCDGVNSIVAKWL-GFK-NPAFVG 83 (315)
Q Consensus 6 ~~~~~i~R~~L~~~L~~~~~~~~i~~~~~v~~~~~~~~~~~v~~~~g~~~~ad~vVgADG~~S~vr~~l-~~~-~~~~~~ 83 (315)
...+.++|..|.+.|.+++..++|+++++|++++.++++++|++++|++++||+||+|||.+|.||+.+ +.. .+.+.+
T Consensus 119 ~~~~~i~r~~l~~~L~~~~~~~~i~~~~~v~~i~~~~~~v~v~~~~g~~~~a~~vV~AdG~~S~vr~~l~~~~~~~~~~~ 198 (407)
T 3rp8_A 119 SRPCPVSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADGSHSALRPWVLGFTPQRRYAG 198 (407)
T ss_dssp SCCEEEEHHHHHHHHHHHHCGGGEEESCCEEEEEEETTEEEEEETTSCEEEESEEEECCCTTCSSHHHHHSSCCCCEEEE
T ss_pred CceEEEEHHHHHHHHHHhCCcCEEEECCEEEEEEecCCcEEEEEcCCCEEeeCEEEECCCcChHHHHHhcCCCCCCcccC
Confidence 457889999999999999877999999999999999999999999999999999999999999999999 775 566777
Q ss_pred ceEEEeeeecCCCCCCCCceEEEecCCeEEEEEecCCCeEEEEEEeeCCCCCcccccChHHHHHHHHHHhcCCChHHHHH
Q 021240 84 RSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLPAQVKAV 163 (315)
Q Consensus 84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 163 (315)
+..+.+.++.+........+..+++++.+++++|.+++...|.+....+.. ...+.+...+.+.+.+.++.+.+..+
T Consensus 199 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~---~~~~~~~~~~~l~~~~~~~~~~~~~~ 275 (407)
T 3rp8_A 199 YVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFFDVPLPAG---LAEDRDTLRADLSRYFAGWAPPVQKL 275 (407)
T ss_dssp EEEEEEEEECCTTTCCTTEEEEEEETTEEEEEEEETTTEEEEEEEEECCTT---CSCCTTTHHHHHHHHTTTCCHHHHHH
T ss_pred cEEEEEEEecccccCCCCceEEEECCCcEEEEEEcCCCeEEEEEEeCCCcC---CCCCchhHHHHHHHHhcCCChHHHHH
Confidence 788888877665444455667778899999999999999888877754332 23345677889999999999999988
Q ss_pred HHcCCCcceeeccccccCcccccccCcCCCcEEEeccCCCCCCCCCccchhhhhhHHHHHHHHHHHHHhccCCCCCCchh
Q 021240 164 IEKTPLDSIISSRLQYRQPQEVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEE 243 (315)
Q Consensus 164 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~LiGDAAh~~~P~~G~G~~~al~da~~La~~l~~~~~~~~~~~~~~~~ 243 (315)
+..........+.+....+. ++|..+||+|||||||.++|++|||+|+||+||..|+++|.. .
T Consensus 276 ~~~~~~~~~~~~~~~~~~~~----~~~~~~rv~LvGDAAh~~~P~~GqG~~~al~da~~La~~L~~---~---------- 338 (407)
T 3rp8_A 276 IAALDPQTTNRIEIHDIEPF----SRLVRGRVALLGDAGHSTTPDIGQGGCAAMEDAVVLGAVFRQ---T---------- 338 (407)
T ss_dssp HHHSCGGGCEEEEEEECCCC----SCCEETTEEECGGGTCCCCGGGSCHHHHHHHHHHHHHHHHHS---C----------
T ss_pred HHcCCccceeEEeeEecCCC----CceecCCEEEEEcccccCCcchhhhHHHHHHHHHHHHHHHhc---C----------
Confidence 87765332211222222222 478999999999999999999999999999999999999985 1
Q ss_pred hhhHHHHHHHHHHHHhhhhhHHHHHHHHHHhhhhhccCchHHHHHHHHHHHHH
Q 021240 244 EFNKRVEMGLKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASF 296 (315)
Q Consensus 244 ~s~~~~~~~l~~Y~~~r~~~~~~~~~~s~~~~~~~~~~~~~~~~~r~~~l~~~ 296 (315)
. ..+.+|+.|+++|++++..+++.++.+..+++..++.....|+..|+..
T Consensus 339 --~-~~~~~l~~Y~~~r~~~~~~~~~~s~~~~~~~~~~~~~~~~~R~~~l~~~ 388 (407)
T 3rp8_A 339 --R-DIAAALREYEAQRCDRVRDLVLKARKRCDITHGKDMQLTEAWYQELREE 388 (407)
T ss_dssp --C-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTHHHHHHHHHHHHSC
T ss_pred --C-CHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhcCCHHHHHHHHHHHhhc
Confidence 1 4688999999999999999999999999999999999999999999744
|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* | Back alignment and structure |
|---|
| >3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} | Back alignment and structure |
|---|
| >2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* | Back alignment and structure |
|---|
| >3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* | Back alignment and structure |
|---|
| >2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* | Back alignment and structure |
|---|
| >2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* | Back alignment and structure |
|---|
| >1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* | Back alignment and structure |
|---|
| >3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* | Back alignment and structure |
|---|
| >2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* | Back alignment and structure |
|---|
| >3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* | Back alignment and structure |
|---|
| >3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} | Back alignment and structure |
|---|
| >2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* | Back alignment and structure |
|---|
| >2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* | Back alignment and structure |
|---|
| >2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* | Back alignment and structure |
|---|
| >1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* | Back alignment and structure |
|---|
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* | Back alignment and structure |
|---|
| >1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* | Back alignment and structure |
|---|
| >1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 | Back alignment and structure |
|---|
| >3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* | Back alignment and structure |
|---|
| >2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* | Back alignment and structure |
|---|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... | Back alignment and structure |
|---|
| >2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* | Back alignment and structure |
|---|
| >2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* | Back alignment and structure |
|---|
| >1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* | Back alignment and structure |
|---|
| >2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* | Back alignment and structure |
|---|
| >2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* | Back alignment and structure |
|---|
| >1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* | Back alignment and structure |
|---|
| >2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* | Back alignment and structure |
|---|
| >3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A | Back alignment and structure |
|---|
| >2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} | Back alignment and structure |
|---|
| >4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* | Back alignment and structure |
|---|
| >2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... | Back alignment and structure |
|---|
| >2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* | Back alignment and structure |
|---|
| >2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* | Back alignment and structure |
|---|
| >1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* | Back alignment and structure |
|---|
| >3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A | Back alignment and structure |
|---|
| >1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* | Back alignment and structure |
|---|
| >3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* | Back alignment and structure |
|---|
| >1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 | Back alignment and structure |
|---|
| >3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* | Back alignment and structure |
|---|
| >1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* | Back alignment and structure |
|---|
| >1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* | Back alignment and structure |
|---|
| >4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* | Back alignment and structure |
|---|
| >3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 315 | ||||
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 2e-05 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 9e-05 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 2e-04 |
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Phenol hydroxylase species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]
Score = 43.2 bits (100), Expect = 2e-05
Identities = 21/89 (23%), Positives = 31/89 (34%), Gaps = 13/89 (14%)
Query: 193 GSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGVGEEDEEEFNKRVEMG 252
V +AGDA H +P GQG ++ D L + L G +
Sbjct: 249 ERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLT-----GRAKRD--------I 295
Query: 253 LKRYAKERRWRCFELISIAYLVGSIQQSD 281
LK Y +ER+ LI + +
Sbjct: 296 LKTYEEERQPFAQALIDFDHQFSRLFSGR 324
|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 315 | |||
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 99.82 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 99.61 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 99.52 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 99.41 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 98.72 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 97.73 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 97.7 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 97.25 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 97.06 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.05 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.02 | |
| d3c96a2 | 111 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 96.91 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 96.88 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 96.7 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 96.48 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 96.29 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 96.29 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 96.15 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 96.04 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 95.98 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 95.71 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 95.52 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.38 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 95.25 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 95.22 | |
| d2voua2 | 128 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 94.77 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 94.77 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 94.48 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 94.47 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 94.02 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 93.99 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 92.98 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 92.97 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 92.93 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 92.49 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 92.1 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 91.32 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 89.72 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 88.19 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 85.96 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 85.52 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 82.1 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 80.86 |
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Monooxygenase PhzS species: Pseudomonas aeruginosa [TaxId: 287]
Probab=99.82 E-value=1e-19 Score=154.44 Aligned_cols=174 Identities=24% Similarity=0.272 Sum_probs=128.3
Q ss_pred ccceeeeHHHHHHHHHhhC----CCCcEEecceEEEEEeeCCeeEEEecCC----CEEeecEEEecCCCchhhhhhhCCC
Q 021240 6 HEMRCVRRKLLLETLAKEL----PSGTIRYSSQVVSIEESGHFKLLHLADG----TILKTKVLIGCDGVNSIVAKWLGFK 77 (315)
Q Consensus 6 ~~~~~i~R~~L~~~L~~~~----~~~~i~~~~~v~~~~~~~~~~~v~~~~g----~~~~ad~vVgADG~~S~vr~~l~~~ 77 (315)
.......+..+...+.+.. ..+++.++++++.++.++++++|+++++ +++++|+||||||.+|.||+.+...
T Consensus 96 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~v~v~~~~g~~~~~~~~ad~vi~ADG~~S~vr~~~~~~ 175 (288)
T d3c96a1 96 YPQYSIHRGELQMILLAAVRERLGQQAVRTGLGVERIEERDGRVLIGARDGHGKPQALGADVLVGADGIHSAVRAHLHPD 175 (288)
T ss_dssp SCEEEEEHHHHHHHHHHHHHHHHCTTSEEESEEEEEEEEETTEEEEEEEETTSCEEEEEESEEEECCCTTCHHHHHHCTT
T ss_pred CcccccchhhhHHHHHHHHHHhccCeeeecCcEEEEeeecCCcEEEEEEcCCCCeEEEeeceeeccCCccceeeeeeccc
Confidence 3444556665555544432 5689999999999999999999999877 3799999999999999998877333
Q ss_pred CCccccceEEEeeeecCCCCCCCCceEEEecCCeEEEEEecCCCeEEEEEEeeCCCCCcccccChHHHHHHHHHHhcCCC
Q 021240 78 NPAFVGRSAIRGYSDFKGSHGFEPNFLQFFGKGLRSGFIPCDDQTIYWFFTWTSSSQDKELEDHSAELKQFVLGKLHDLP 157 (315)
Q Consensus 78 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 157 (315)
.......
T Consensus 176 ~~~~~~~------------------------------------------------------------------------- 182 (288)
T d3c96a1 176 QRPLRDP------------------------------------------------------------------------- 182 (288)
T ss_dssp CCCCCCC-------------------------------------------------------------------------
T ss_pred ccccccc-------------------------------------------------------------------------
Confidence 1111000
Q ss_pred hHHHHHHHcCCCcceeeccccccCcccccccCcCCCcEEEeccCCCCCCCCCccchhhhhhHHHHHHHHHHHHHhccCCC
Q 021240 158 AQVKAVIEKTPLDSIISSRLQYRQPQEVLWGNISRGSVCVAGDALHPMTPDIGQGGCAALEDGIVLARCINEALKTKQGV 237 (315)
Q Consensus 158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~LiGDAAh~~~P~~G~G~~~al~da~~La~~l~~~~~~~~~~ 237 (315)
...|..++++++|||+|.++|+.|||+++||+|+..|++.|.+ .
T Consensus 183 -----------------------------~~~~~~~~~~~~gda~h~~~p~~g~G~~~ai~d~~~l~~~l~~---~---- 226 (288)
T d3c96a1 183 -----------------------------LPHWGRGRITLLGDAAHLMYPMGANGASQAILDGIELAAALAR---N---- 226 (288)
T ss_dssp -----------------------------CSCCCBTTEEECTHHHHCCCSSTTCTHHHHHHHHHHHHHHHHH---C----
T ss_pred -----------------------------ccccccCcceecccccceeCCccccchhhhhhhHHHHHHHHhh---C----
Confidence 0124678999999999999999999999999999999999976 2
Q ss_pred CCCchhhhhHHHHHHHHHHHHhhhhhHHHHHHHHHHhhhhhccCchHHHHHHHHHHHHHH
Q 021240 238 GEEDEEEFNKRVEMGLKRYAKERRWRCFELISIAYLVGSIQQSDGKILNFLRDKILASFL 297 (315)
Q Consensus 238 ~~~~~~~s~~~~~~~l~~Y~~~r~~~~~~~~~~s~~~~~~~~~~~~~~~~~r~~~l~~~~ 297 (315)
.+.+.+|+.|++.|+++++.++..++................++..+..+.
T Consensus 227 ---------~~~~~al~~y~~~r~pr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 277 (288)
T d3c96a1 227 ---------ADVAAALREYEEARRPTANKIILANREREKEEWAAASRPKTEKSAALEAIT 277 (288)
T ss_dssp ---------SSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC------------
T ss_pred ---------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCchHHHHHHHHHHHh
Confidence 256789999999999999999999998888776555556666777776544
|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d3c96a2 d.16.1.2 (A:183-293) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2voua2 d.16.1.2 (A:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|