Citrus Sinensis ID: 021247


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MKFAGLKSVENAHEESVWAVTWVPATETRPALLLTGSLDETVKLWRPDDMQLERTNTGHCLGVVSVAAHPSGIIAASASLDSFVRVFDVDTNASIATLEASPSEVWQMQFDPKGTTLAVAGGGSASVKLWDTATWNLIATLSIPRPEGLKPTDKSSSKKFVLSVAWSPDGRRIACGSMDGTISVFDVTRAKFLHHLEGHFMPVRSLVYSPVDPRVLFSASDDTHVHMYDAEGKSLVTAMSGHASWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS
ccccccccccccccccEEEEEEcccccccccEEEEccccccEEEEEcccccEEEccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEECcccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccccccccccccccccEEEEEEcccccEEEEccccccEEEEEccccEEEcccccccccEEEEEEccccccEEEEEcccccEEEEEccccEEEEccccccccEEEEEEcccccEEEEccccccEEEEEccccccccccccccccEEEEEEcccccEEEEECccccEEEEEcc
MKFAGLKSVENAHEESVWAVTWVPATETRPALLLTGSLDETVKLWRPDDMQLERTNTGHCLGVVSVAAHPSGIIAASASLDSFVRVFDVDTNASIATLEASPSEVWQMQFDPKGTTLAVAGGGSASVKLWDTATWNLIATLSIPRPEGLKPTDKSSSKKFVLSVAWSPDGRRIACGSMDGTISVFDVTRAKFLHHLEGHFMPVRSLVYSPVDPRVLFSASDDTHVHMYDAEGKSLVTAMSGHASWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFAGLKSVENAHEESVWAVTWVPATETRPALLLTGSLDETVKLWRPDDMQLERTNTGHCLGVVSVAAHPSGIIAASASLDSFVRVFDVDTNASIATLEASPSEVWQMQFDPKGTTLAVAGGGSASVKLWDTATWNLIATLSIPRPEGLKPTDKSSSKKFVLSVAWSPDGRRIACGSMDGTISVFDVTRAKFLHHLEGHFMPVRSLVYSPVDPRVLFSASDDTHVHMYDAEGKSLVTAMSGHASWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WD repeat-containing protein 61 Component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. PAF1C associates with RNA polymerase II through interaction with POLR2A CTD non-phosphorylated and 'Ser-2'- and 'Ser-5'-phosphorylated forms and is involved in transcriptional elongation, acting both indepentently and synergistically with TCEA1 and in cooperation with the DSIF complex and HTATSF1. PAF1C is required for transcription of Hox and Wnt target genes. PAF1C is involved in hematopoiesis and stimulates transcriptional activity of MLL1. PAF1C is involved in histone modifications such as ubiquitination of histone H2B and methylation on histone H3 'Lys-4' (H3K4me3). PAF1C recruits the RNF20/40 E3 ubiquitin-protein ligase complex and the E2 enzyme UBE2A or UBE2B to chromatin which mediate monoubiquitination of 'Lys-120' of histone H2B (H2BK120ub1); UB2A/B-mediated H2B ubiquitination is proposed to be coupled to transcription. PAF1C is involved in mRNA 3' end formation probably through association with cleavage and poly(A) factors. Required for mono- and trimethylation on histone H3 'Lys-4' (H3K4me3), dimethylation on histone H3 'Lys-79' (H3K4me3). Required for Hox gene transcription. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1C.probableQ4V7A0
WD repeat-containing protein 61 probableQ5ZJH5
WD repeat-containing protein 61 probableQ6P5M2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 10-315
View the alignment between query and template
View the model in PyMOL