Citrus Sinensis ID: 021270

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----

MKNCERIANLALAGLTLAPLLVKVDPNLNVILTACLTVYVGCYRSVKPTPPSETMSNEHAMRFPFVGSAMLLSLFLLFKFLSKDLVNAVLTCYFFVLGIIALSATILPAVKRFLPNHWNEDLIIWHFPYFRSLEIEFTRSQIIAAIPGTFFCAWYASQKHWLANNTLGLAFCIQGIEMLSLGSFKTGAILLAGLFVYDIFWVFFTPVMVSVAKSFDAPIKLLFPTRDTARPFSMLGLGDIVIPGIFVALALRFDVSRGKGSRYFKSAFLGYTVGLVLTIIVMNWFQAAQVTIACFFSFVFPLNVHVPRNYSPICY

ccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccHHHHHHccccccccccCEECccccccccEEEEHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHcccccccEEEEccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEccccccccccc

*****RIANLALAGLTLAPLLVKVDPNLNVILTACLTVYVGCYRSV************HAMRFPFVGSAMLLSLFLLFKFLSKDLVNAVLTCYFFVLGIIALSATILPAVKRFLPNHWNEDLIIWHFPYFRSLEIEFTRSQIIAAIPGTFFCAWYASQKHWLANNTLGLAFCIQGIEMLSLGSFKTGAILLAGLFVYDIFWVFFTPVMVSVAKSFDAPIKLLFPTRDTARPFSMLGLGDIVIPGIFVALALRFDVSRGKGSRYFKSAFLGYTVGLVLTIIVMNWFQAAQVTIACFFSFVFPLNVHVPRNYSPICY

xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Signal peptide peptidase 2	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane (By similarity). Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm.	confident	B9FJ61
Signal peptide peptidase 1	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane (By similarity). Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm.	confident	Q6ZGL9
Signal peptide peptidase	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane (By similarity). Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm (By similarity). Plays a critical role in the development and function of the reproductive tissues, especially in pollen development.	confident	O81062

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HYG, chain A
Confidence level:confident
Coverage over the Query: 57-116,137-214,231-300
View the alignment between query and template
View the model in PyMOL