Citrus Sinensis ID: 021276


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----
MPNDSHAPNSKGILCNAGAGAAAGIIAATFVCPLDVIKTRLQVHGLPKLTNGTVKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKSFLCSEDKNHHLSVGANVIAAAVAGAATTIATNPLWVVKTRLQTQGMKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPTYEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQPHTL
cccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcHHHHcccHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccHHHHcccHHHHHHHHHHHHHHHHHccccccccccc
***********GILCNAGAGAAAGIIAATFVCPLDVIKTRLQVHGLPKLTNGTVKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKSFLCSEDKNHHLSVGANVIAAAVAGAATTIATNPLWVVKTRLQTQGMKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPTYEKIKMHLAD**********ARDVAVASSVSKIFASTLTYPHEVVRS************YSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYF*********
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNDSHAPNSKGILCNAGAGAAAGIIAATFVCPLDVIKTRLQVHGLPKLTNGTVKGSLIVGSLEQIFQKEGLRGMYRGLSPTVLALLPNWAVYFTMYEQLKSFLCSEDKNHHLSVGANVIAAAVAGAATTIATNPLWVVKTRLQTQGMKAGVVPYRSTLSALSRIAQEEGIRGLYSGLVPALAGISHVAIQFPTYEKIKMHLADQGNTSMDKLSARDVAVASSVSKIFASTLTYPHEVVRSRLQEQGHHSEKRYSGVVDCIKKVFQQEGLPGFYRGCATNLLRTTPAAVITFTSFEMIHRFLVSYFPPDPQPHTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nicotinamide adenine dinucleotide transporter 1, chloroplastic Mediates the NAD(+) import into chloroplast. Favors the NAD(+)(in)/ADP or AMP(out) antiport exchange, but is also able to catalyze a low unidirectional transport (uniport) of NAD(+). Transports NAD(+), nicotinic acid adenine dinucleotide, nicotinamide mononucleotide, nicotinic acid mononucleotide, FAD, FMN, TTP, TDP, TMP, UTP, UDP, UMP, CTP, CDP, CMP, GTP, GDP, GMP, 3'-AMP, ATP, ADP, AND AMP, has low transport activity with cAMP, pyrophosphate, NADH and alpha-NAD(+), and has no activity with NADP(+), NADPH, nicotinamide, nicotinic acid, adenosine, thiamine mono- or diphosphate, inorganic phosphate, CoA, folate, NaCl, malate, malonate, citrate, fumarate, aspartate, glutamate, S-adenosylmethionine, lysine, arginine, and ornithine.confidentO22261
Mitochondrial folate transporter/carrier Transports folate across the inner membranes of mitochondria.probableQ8BMG8
Mitochondrial substrate carrier family protein W Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane.probableQ54FU9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LCK, chain A
Confidence level:very confident
Coverage over the Query: 15-308
View the alignment between query and template
View the model in PyMOL