Citrus Sinensis ID: 021281

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

MDYTSKGFDETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHDYRLKW

ccccccccccccccccccccccccccCEEEEECccccccccHHHHHHHHHHHHHccccEEECccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEECccccccHHHHHHHHHHHcccEEEEEECcccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHHHccccccccccccccEEEcccccccccccccccccccc

**********************NGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQV******KW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable alpha-amylase 2	Probable alpha-amylase that does not seem to be required for breakdown of transitory starch in leaves.	probable	Q8LFG1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HT6, chain A
Confidence level:very confident
Coverage over the Query: 25-309
View the alignment between query and template
View the model in PyMOL

Template: 4H41, chain A
Confidence level:probable
Coverage over the Query: 13-111
View the alignment between query and template
View the model in PyMOL