Citrus Sinensis ID: 021281


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MDYTSKGFDETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHDYRLKW
ccccccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHcccEEEEEEEcccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHHHHcccccccccccccEEEcccccccccccccccccccc
cccccccccccccccccccccccccccEEEcccccHHHccHHHHHHccHHHHHHHcccEEEccccccEcccccccEccccccccccccHHHHHHHHHHHHHcccEEEEEEEEEcccccccccccEEEEEcccccccccccccccccccccccccEccccccEEccccHHHHHHHHHHHHHHHHcccccEEEEccHHHccHHHHHHHHHHHcccEEEEcccccccEccccccccccHHHHHHHHHHcHHHccEEEEcHHHHHHHHHHccccHHHccccccccccHHHHcHHHEEEEccccccccccccccccccc
mdytskgfdetnqqtdlgaVIRNGReilfqgfnwesckHDWWRNlerkvpdisksgftsvwlppathsfapegylpqnlyslnssYGSEHLLKALLHKMKQHKVRAMADIVInhrvgttqghggkynrydgiplswdehavtsctgglgngstgdnfhgvpnidhtqHFVRKDIIAWLRWLRNTvgfqdfrfdfargySAKYVKEYIEgarpifsvgeywdscnynshgldynqdsHRQRIINWidgtgqlsaafdfTTKGILQEAVKGQFWRlrdaqgkppgvmgwwpsravtfldnhdtgstqvphdyrlkw
mdytskgfdetnqqtdlgaVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHrvgttqghggkyNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLdnhdtgstqvphdyrlkw
MDYTSKGFDETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHDYRLKW
****************LGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDN****************
*************************EILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQV******KW
*********ETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHDYRLKW
**********************NGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGS**VP*D*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYTSKGFDETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHDYRLKW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query314 2.2.26 [Sep-21-2011]
Q8LFG1413 Probable alpha-amylase 2 yes no 0.974 0.740 0.833 1e-153
Q94A41887 Alpha-amylase 3, chloropl no no 0.898 0.317 0.517 1e-83
P27932 440 Alpha-amylase isozyme 3A no no 0.891 0.636 0.465 1e-71
P04747368 Alpha-amylase type B isoz N/A no 0.891 0.760 0.479 2e-71
P04063427 Alpha-amylase type B isoz N/A no 0.891 0.655 0.479 2e-71
A2YGY2 446 Alpha-amylase isozyme 2A N/A no 0.901 0.634 0.473 3e-71
Q0D9J1 445 Alpha-amylase isozyme 2A no no 0.901 0.635 0.473 4e-71
P17859421 Alpha-amylase OS=Vigna mu N/A no 0.888 0.662 0.462 4e-71
P27934 437 Alpha-amylase isozyme 3E no no 0.891 0.640 0.469 2e-70
P00693 438 Alpha-amylase type A isoz N/A no 0.894 0.641 0.462 4e-70
>sp|Q8LFG1|AMY2_ARATH Probable alpha-amylase 2 OS=Arabidopsis thaliana GN=AMY2 PE=2 SV=1 Back     alignment and function desciption
 Score =  541 bits (1393), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 255/306 (83%), Positives = 277/306 (90%)

Query: 1   MDYTSKGFDETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSV 60
           M Y +  FDE N QTD+G VIR+GRE++ Q +NWES K+DWWRNL+ KVPDI+KSGFTS 
Sbjct: 1   MGYYNNVFDECNDQTDIGRVIRDGREVILQAYNWESHKYDWWRNLDGKVPDIAKSGFTSA 60

Query: 61  WLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQ 120
           WLPP + S APEGYLPQ+LYSLNS+YGSEHLLK+LL KMKQ+KVRAMADIVINHRVGTT+
Sbjct: 61  WLPPPSQSLAPEGYLPQDLYSLNSAYGSEHLLKSLLRKMKQYKVRAMADIVINHRVGTTR 120

Query: 121 GHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRW 180
           GHGG YNRYDGI L WDEHAVTSCTGGLGN STGDNF+GVPN+DHTQHFVRKDII WLRW
Sbjct: 121 GHGGMYNRYDGISLPWDEHAVTSCTGGLGNRSTGDNFNGVPNVDHTQHFVRKDIIGWLRW 180

Query: 181 LRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQR 240
           LRNTVGFQDFRFDFARGYSA YVKEYI  A+P+FSVGE WDSCNYN HGLDYNQDSHRQR
Sbjct: 181 LRNTVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQDSHRQR 240

Query: 241 IINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHD 300
           II+WID TGQ+SAAFDFTTKGILQEAVKGQ+WRL DAQGKPPGVMGWWPSRAVTFLDNHD
Sbjct: 241 IISWIDATGQISAAFDFTTKGILQEAVKGQYWRLCDAQGKPPGVMGWWPSRAVTFLDNHD 300

Query: 301 TGSTQV 306
           TGSTQ 
Sbjct: 301 TGSTQA 306




Probable alpha-amylase that does not seem to be required for breakdown of transitory starch in leaves.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1
>sp|Q94A41|AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana GN=AMY3 PE=1 SV=1 Back     alignment and function description
>sp|P27932|AMY3A_ORYSJ Alpha-amylase isozyme 3A OS=Oryza sativa subsp. japonica GN=AMY1.2 PE=2 SV=2 Back     alignment and function description
>sp|P04747|AMY3_HORVU Alpha-amylase type B isozyme (Fragment) OS=Hordeum vulgare GN=AMY1.3 PE=2 SV=1 Back     alignment and function description
>sp|P04063|AMY2_HORVU Alpha-amylase type B isozyme OS=Hordeum vulgare GN=AMY1.2 PE=1 SV=3 Back     alignment and function description
>sp|A2YGY2|AMY2A_ORYSI Alpha-amylase isozyme 2A OS=Oryza sativa subsp. indica GN=AMYC2 PE=2 SV=1 Back     alignment and function description
>sp|Q0D9J1|AMY2A_ORYSJ Alpha-amylase isozyme 2A OS=Oryza sativa subsp. japonica GN=AMY2A PE=2 SV=1 Back     alignment and function description
>sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 Back     alignment and function description
>sp|P27934|AMY3E_ORYSJ Alpha-amylase isozyme 3E OS=Oryza sativa subsp. japonica GN=AMY1.4 PE=2 SV=1 Back     alignment and function description
>sp|P00693|AMY1_HORVU Alpha-amylase type A isozyme OS=Hordeum vulgare GN=AMY1.1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
68053506407 alpha-amylase 2 [Manihot esculenta] 0.952 0.734 0.859 1e-153
60652323414 cytosolic alpha-amylase [Malus x domesti 0.945 0.717 0.861 1e-152
7532799413 alpha-amylase [Malus x domestica] 0.974 0.740 0.843 1e-152
297839489413 hypothetical protein ARALYDRAFT_316534 [ 0.974 0.740 0.833 1e-151
359492943411 PREDICTED: alpha-amylase type B isozyme- 0.968 0.739 0.869 1e-151
15222959413 alpha-amylase-like 2 [Arabidopsis thalia 0.974 0.740 0.833 1e-151
224065715406 predicted protein [Populus trichocarpa] 0.939 0.726 0.864 1e-150
52851182413 alpha-amylase [Plantago major] 0.964 0.733 0.828 1e-147
68300879360 alpha-amylase 1 large isoform [Nicotiana 0.936 0.816 0.836 1e-147
255539112398 alpha-amylase, putative [Ricinus communi 0.917 0.723 0.847 1e-146
>gi|68053506|gb|AAY85174.1| alpha-amylase 2 [Manihot esculenta] Back     alignment and taxonomy information
 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 257/299 (85%), Positives = 275/299 (91%)

Query: 7   GFDETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPAT 66
           GF E N+QTD+G  ++NGREI+ Q FNWES KHDWWRNLERKVPDI+KSGFTS WLPP++
Sbjct: 2   GFAENNKQTDIGGAVQNGREIILQAFNWESHKHDWWRNLERKVPDIAKSGFTSAWLPPSS 61

Query: 67  HSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKY 126
            SFAPEGYLPQNLYSLNSSYGSEHLL+AL+ KMKQ  VRAMADIVINHRVGTTQGHGG Y
Sbjct: 62  QSFAPEGYLPQNLYSLNSSYGSEHLLRALIQKMKQSNVRAMADIVINHRVGTTQGHGGMY 121

Query: 127 NRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVG 186
           NRYDGIPLSWDE AVTSCTGGLGN STGDNFHGVPNIDH+QHFVRKDI AWL+WLRN VG
Sbjct: 122 NRYDGIPLSWDERAVTSCTGGLGNRSTGDNFHGVPNIDHSQHFVRKDITAWLQWLRNNVG 181

Query: 187 FQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWID 246
           FQDFRFDFARGYS KYVKEYIEGA+PIFSV EYWDSCNY+   L+YNQDSHRQRIINWID
Sbjct: 182 FQDFRFDFARGYSPKYVKEYIEGAKPIFSVWEYWDSCNYSGSYLEYNQDSHRQRIINWID 241

Query: 247 GTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQ 305
           GTGQLS AFDFTTKGILQEAVKGQFWRLRD+ GKPPGV+GWWPSRAVTF+DNHDTGSTQ
Sbjct: 242 GTGQLSTAFDFTTKGILQEAVKGQFWRLRDSPGKPPGVIGWWPSRAVTFIDNHDTGSTQ 300




Source: Manihot esculenta

Species: Manihot esculenta

Genus: Manihot

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|60652323|gb|AAX33234.1| cytosolic alpha-amylase [Malus x domestica] Back     alignment and taxonomy information
>gi|7532799|gb|AAF63239.1|AF153828_1 alpha-amylase [Malus x domestica] Back     alignment and taxonomy information
>gi|297839489|ref|XP_002887626.1| hypothetical protein ARALYDRAFT_316534 [Arabidopsis lyrata subsp. lyrata] gi|297333467|gb|EFH63885.1| hypothetical protein ARALYDRAFT_316534 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359492943|ref|XP_002284805.2| PREDICTED: alpha-amylase type B isozyme-like [Vitis vinifera] gi|302141692|emb|CBI18895.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15222959|ref|NP_177740.1| alpha-amylase-like 2 [Arabidopsis thaliana] gi|75301385|sp|Q8LFG1.1|AMY2_ARATH RecName: Full=Probable alpha-amylase 2; Short=AtAMY2; AltName: Full=1,4-alpha-D-glucan glucanohydrolase gi|21537093|gb|AAM61434.1| alpha-amylase, putative [Arabidopsis thaliana] gi|62320476|dbj|BAD94995.1| alpha-amylase like protein [Arabidopsis thaliana] gi|98960989|gb|ABF58978.1| At1g76130 [Arabidopsis thaliana] gi|332197679|gb|AEE35800.1| alpha-amylase-like 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224065715|ref|XP_002301935.1| predicted protein [Populus trichocarpa] gi|222843661|gb|EEE81208.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|52851182|emb|CAH58639.1| alpha-amylase [Plantago major] Back     alignment and taxonomy information
>gi|68300879|gb|AAY89372.1| alpha-amylase 1 large isoform [Nicotiana langsdorffii x Nicotiana sanderae] Back     alignment and taxonomy information
>gi|255539112|ref|XP_002510621.1| alpha-amylase, putative [Ricinus communis] gi|223551322|gb|EEF52808.1| alpha-amylase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
TAIR|locus:2199808413 AMY2 "alpha-amylase-like 2" [A 0.971 0.738 0.836 3.9e-147
TAIR|locus:2196759887 AMY3 "alpha-amylase-like 3" [A 0.898 0.317 0.517 1.2e-81
UNIPROTKB|P27934 437 AMY1.4 "Alpha-amylase isozyme 0.891 0.640 0.469 7.7e-71
UNIPROTKB|P27932 440 AMY1.2 "Alpha-amylase isozyme 0.891 0.636 0.469 1.6e-70
TAIR|locus:2117398423 AMY1 "alpha-amylase-like" [Ara 0.891 0.661 0.474 1.3e-68
UNIPROTKB|P17654434 AMY1.1 "Alpha-amylase" [Oryza 0.891 0.645 0.462 1.7e-68
UNIPROTKB|P27933 436 AMY1.3 "Alpha-amylase isozyme 0.891 0.642 0.455 4.4e-68
UNIPROTKB|P27939 437 AMY1.7 "Alpha-amylase isozyme 0.891 0.640 0.445 1.7e-66
UNIPROTKB|P27937 438 AMY1.6 "Alpha-amylase isozyme 0.891 0.639 0.445 3.6e-66
UNIPROTKB|Q2KEQ7 600 MGCH7_ch7g979 "Putative unchar 0.547 0.286 0.275 1.2e-11
TAIR|locus:2199808 AMY2 "alpha-amylase-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1437 (510.9 bits), Expect = 3.9e-147, P = 3.9e-147
 Identities = 255/305 (83%), Positives = 277/305 (90%)

Query:     1 MDYTSKGFDETNQQTDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSV 60
             M Y +  FDE N QTD+G VIR+GRE++ Q +NWES K+DWWRNL+ KVPDI+KSGFTS 
Sbjct:     1 MGYYNNVFDECNDQTDIGRVIRDGREVILQAYNWESHKYDWWRNLDGKVPDIAKSGFTSA 60

Query:    61 WLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQ 120
             WLPP + S APEGYLPQ+LYSLNS+YGSEHLLK+LL KMKQ+KVRAMADIVINHRVGTT+
Sbjct:    61 WLPPPSQSLAPEGYLPQDLYSLNSAYGSEHLLKSLLRKMKQYKVRAMADIVINHRVGTTR 120

Query:   121 GHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRW 180
             GHGG YNRYDGI L WDEHAVTSCTGGLGN STGDNF+GVPN+DHTQHFVRKDII WLRW
Sbjct:   121 GHGGMYNRYDGISLPWDEHAVTSCTGGLGNRSTGDNFNGVPNVDHTQHFVRKDIIGWLRW 180

Query:   181 LRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGLDYNQDSHRQR 240
             LRNTVGFQDFRFDFARGYSA YVKEYI  A+P+FSVGE WDSCNYN HGLDYNQDSHRQR
Sbjct:   181 LRNTVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQDSHRQR 240

Query:   241 IINWIDGTGQLSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHD 300
             II+WID TGQ+SAAFDFTTKGILQEAVKGQ+WRL DAQGKPPGVMGWWPSRAVTFLDNHD
Sbjct:   241 IISWIDATGQISAAFDFTTKGILQEAVKGQYWRLCDAQGKPPGVMGWWPSRAVTFLDNHD 300

Query:   301 TGSTQ 305
             TGSTQ
Sbjct:   301 TGSTQ 305




GO:0003824 "catalytic activity" evidence=IEA
GO:0004556 "alpha-amylase activity" evidence=IEA;ISS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM;TAS
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
TAIR|locus:2196759 AMY3 "alpha-amylase-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P27934 AMY1.4 "Alpha-amylase isozyme 3E" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27932 AMY1.2 "Alpha-amylase isozyme 3A" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2117398 AMY1 "alpha-amylase-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P17654 AMY1.1 "Alpha-amylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27933 AMY1.3 "Alpha-amylase isozyme 3D" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27939 AMY1.7 "Alpha-amylase isozyme 3C" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P27937 AMY1.6 "Alpha-amylase isozyme 3B" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KEQ7 MGCH7_ch7g979 "Putative uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LFG1AMY2_ARATH3, ., 2, ., 1, ., 10.83330.97450.7409yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
PLN02361401 PLN02361, PLN02361, alpha-amylase 0.0
cd11314302 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase 1e-128
PLN02784894 PLN02784, PLN02784, alpha-amylase 1e-118
PLN00196428 PLN00196, PLN00196, alpha-amylase; Provisional 2e-97
PRK09441 479 PRK09441, PRK09441, cytoplasmic alpha-amylase; Rev 1e-30
cd11318391 cd11318, AmyAc_bac_fung_AmyA, Alpha amylase cataly 2e-30
cd11319375 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic d 6e-13
smart00642166 smart00642, Aamy, Alpha-amylase domain 4e-12
cd00551260 cd00551, AmyAc_family, Alpha amylase catalytic dom 2e-09
pfam00128314 pfam00128, Alpha-amylase, Alpha amylase, catalytic 3e-09
cd11315352 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic 2e-08
COG0366 505 COG0366, AmyA, Glycosidases [Carbohydrate transpor 2e-05
cd11320389 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase 6e-05
cd11339344 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catal 0.001
>gnl|CDD|177990 PLN02361, PLN02361, alpha-amylase Back     alignment and domain information
 Score =  597 bits (1541), Expect = 0.0
 Identities = 254/293 (86%), Positives = 269/293 (91%), Gaps = 2/293 (0%)

Query: 15  TDLGAVIRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGY 74
           TD GAVIRNGREIL Q FNWES KHDWWRNLE KVPD++KSGFTS WLPP + S APEGY
Sbjct: 1   TDNGAVIRNGREILLQAFNWESHKHDWWRNLEGKVPDLAKSGFTSAWLPPPSQSLAPEGY 60

Query: 75  LPQNLYSLNSSYGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPL 134
           LPQNLYSLNS+YGSEHLLK+LL KMKQ+ VRAMADIVINHRVGTTQGHGG YNRYDGIPL
Sbjct: 61  LPQNLYSLNSAYGSEHLLKSLLRKMKQYNVRAMADIVINHRVGTTQGHGGMYNRYDGIPL 120

Query: 135 SWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDF 194
            WDEHAVTSCTGGLGN STGDNF+GVPNIDHTQHFVRKDII WL WLRN VGFQDFRFDF
Sbjct: 121 PWDEHAVTSCTGGLGNRSTGDNFNGVPNIDHTQHFVRKDIIGWLIWLRNDVGFQDFRFDF 180

Query: 195 ARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHG--LDYNQDSHRQRIINWIDGTGQLS 252
           A+GYSAK+VKEYIE A+P+FSVGEYWDSCNY+     LDYNQDSHRQRI+NWIDGTG LS
Sbjct: 181 AKGYSAKFVKEYIEAAKPLFSVGEYWDSCNYSGPDYRLDYNQDSHRQRIVNWIDGTGGLS 240

Query: 253 AAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQ 305
           AAFDFTTKGILQEAVKGQ+WRLRDAQGKPPGVMGWWPSRAVTF+DNHDTGSTQ
Sbjct: 241 AAFDFTTKGILQEAVKGQWWRLRDAQGKPPGVMGWWPSRAVTFIDNHDTGSTQ 293


Length = 401

>gnl|CDD|200453 cd11314, AmyAc_arch_bac_plant_AmyA, Alpha amylase catalytic domain found in archaeal, bacterial, and plant Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|215419 PLN02784, PLN02784, alpha-amylase Back     alignment and domain information
>gnl|CDD|165762 PLN00196, PLN00196, alpha-amylase; Provisional Back     alignment and domain information
>gnl|CDD|236518 PRK09441, PRK09441, cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>gnl|CDD|200457 cd11318, AmyAc_bac_fung_AmyA, Alpha amylase catalytic domain found in bacterial and fungal Alpha amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|200458 cd11319, AmyAc_euk_AmyA, Alpha amylase catalytic domain found in eukaryotic Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|214758 smart00642, Aamy, Alpha-amylase domain Back     alignment and domain information
>gnl|CDD|200451 cd00551, AmyAc_family, Alpha amylase catalytic domain family Back     alignment and domain information
>gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain Back     alignment and domain information
>gnl|CDD|200454 cd11315, AmyAc_bac1_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) Back     alignment and domain information
>gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins Back     alignment and domain information
>gnl|CDD|200478 cd11339, AmyAc_bac_CMD_like_2, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 314
PLN02361401 alpha-amylase 100.0
PLN02784894 alpha-amylase 100.0
PLN00196428 alpha-amylase; Provisional 100.0
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 100.0
PRK09505 683 malS alpha-amylase; Reviewed 100.0
PRK10785 598 maltodextrin glucosidase; Provisional 100.0
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 100.0
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 100.0
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 100.0
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 100.0
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 100.0
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 100.0
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 100.0
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 100.0
PRK13840 495 sucrose phosphorylase; Provisional 100.0
PRK03705 658 glycogen debranching enzyme; Provisional 100.0
PRK12313 633 glycogen branching enzyme; Provisional 100.0
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 100.0
PRK05402 726 glycogen branching enzyme; Provisional 100.0
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 100.0
TIGR03852 470 sucrose_gtfA sucrose phosphorylase. In the forward 100.0
PRK14706 639 glycogen branching enzyme; Provisional 100.0
PLN02960 897 alpha-amylase 100.0
PRK12568 730 glycogen branching enzyme; Provisional 100.0
COG0366 505 AmyA Glycosidases [Carbohydrate transport and meta 100.0
PLN02447 758 1,4-alpha-glucan-branching enzyme 100.0
PRK14705 1224 glycogen branching enzyme; Provisional 100.0
KOG2212 504 consensus Alpha-amylase [Carbohydrate transport an 100.0
KOG0471 545 consensus Alpha-amylase [Carbohydrate transport an 100.0
TIGR02455 688 TreS_stutzeri trehalose synthase, Pseudomonas stut 99.97
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 99.97
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 99.97
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 99.97
PLN02877 970 alpha-amylase/limit dextrinase 99.97
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 99.96
smart00642166 Aamy Alpha-amylase domain. 99.94
KOG0470 757 consensus 1,4-alpha-glucan branching enzyme/starch 99.94
PRK14511 879 maltooligosyl trehalose synthase; Provisional 99.91
PLN03244 872 alpha-amylase; Provisional 99.88
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 99.87
COG3280 889 TreY Maltooligosyl trehalose synthase [Carbohydrat 99.82
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 99.58
PF14872 811 GHL5: Hypothetical glycoside hydrolase 5 99.19
PF14701 423 hDGE_amylase: glucanotransferase domain of human g 98.97
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 98.83
PF02324809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 98.78
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 98.58
COG1649418 Uncharacterized protein conserved in bacteria [Fun 98.27
PF02324 809 Glyco_hydro_70: Glycosyl hydrolase family 70; Inte 97.98
KOG3625 1521 consensus Alpha amylase [Carbohydrate transport an 97.79
cd06592303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 97.7
cd06593308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 97.67
PF02065394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 97.56
cd06597340 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide 97.38
PRK14582671 pgaB outer membrane N-deacetylase; Provisional 97.28
PF13199 559 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 97.27
cd06599317 GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 97.08
PF13200316 DUF4015: Putative glycosyl hydrolase domain 96.63
cd06594317 GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl 96.63
PF14488166 DUF4434: Domain of unknown function (DUF4434) 96.59
cd06591319 GH31_xylosidase_XylS XylS is a glycosyl hydrolase 96.47
cd06600317 GH31_MGAM-like This family includes the following 96.26
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 96.24
PF01055 441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 96.05
PRK10658 665 putative alpha-glucosidase; Provisional 95.76
PRK10426 635 alpha-glucosidase; Provisional 95.71
cd06602339 GH31_MGAM_SI_GAA This family includes the followin 95.67
cd06598317 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide 95.45
COG3589360 Uncharacterized conserved protein [Function unknow 95.36
cd06604339 GH31_glucosidase_II_MalA Alpha-glucosidase II (alp 95.17
PLN02635 538 disproportionating enzyme 95.16
cd06542255 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases 94.88
cd06562348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 94.64
COG1501 772 Alpha-glucosidases, family 31 of glycosyl hydrolas 94.39
PF02446 496 Glyco_hydro_77: 4-alpha-glucanotransferase; InterP 94.25
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 94.07
PRK14508 497 4-alpha-glucanotransferase; Provisional 94.04
KOG1065 805 consensus Maltase glucoamylase and related hydrola 93.91
PLN02763 978 hydrolase, hydrolyzing O-glycosyl compounds 93.72
PLN03236 745 4-alpha-glucanotransferase; Provisional 93.71
PLN02950 909 4-alpha-glucanotransferase 93.69
cd06595292 GH31_xylosidase_XylS-like This family represents a 93.57
TIGR01531 1464 glyc_debranch glycogen debranching enzymye. glycog 93.49
PLN02635538 disproportionating enzyme 93.45
smart00812384 Alpha_L_fucos Alpha-L-fucosidase. O-Glycosyl hydro 93.41
TIGR01370315 cysRS possible cysteinyl-tRNA synthetase, Methanoc 93.4
PF02449 374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 93.15
cd06601332 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) 92.9
cd06545253 GH18_3CO4_chitinase The Bacteroides thetaiotaomicr 92.86
PRK11052 695 malQ 4-alpha-glucanotransferase; Provisional 92.66
PRK14508497 4-alpha-glucanotransferase; Provisional 92.42
PF14883294 GHL13: Hypothetical glycosyl hydrolase family 13 92.35
PF10566273 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: 91.82
PF05913357 DUF871: Bacterial protein of unknown function (DUF 91.76
cd06565301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 91.7
cd02875 358 GH18_chitobiase Chitobiase (also known as di-N-ace 91.66
PRK11052 695 malQ 4-alpha-glucanotransferase; Provisional 91.6
cd06564326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 91.54
cd06603339 GH31_GANC_GANAB_alpha This family includes the clo 91.46
PF01120346 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 91.26
cd02742303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 91.06
cd06589265 GH31 The enzymes of glycosyl hydrolase family 31 ( 91.05
TIGR00217 513 malQ 4-alpha-glucanotransferase. This enzyme is kn 91.05
cd06569 445 GH20_Sm-chitobiase-like The chitobiase of Serratia 90.58
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 89.76
cd02871312 GH18_chitinase_D-like GH18 domain of Chitinase D ( 89.35
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 88.82
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 88.62
PF07555306 NAGidase: beta-N-acetylglucosaminidase ; InterPro: 88.6
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 88.49
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 88.11
cd06568329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 87.89
cd06563357 GH20_chitobiase-like The chitobiase of Serratia ma 86.93
PF00728351 Glyco_hydro_20: Glycosyl hydrolase family 20, cata 86.67
cd06570311 GH20_chitobiase-like_1 A functionally uncharacteri 86.59
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 86.23
PRK15447301 putative protease; Provisional 85.54
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 85.23
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 84.79
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 83.69
COG2342300 Predicted extracellular endo alpha-1,4 polygalacto 83.5
PF02446496 Glyco_hydro_77: 4-alpha-glucanotransferase; InterP 83.23
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 83.16
PLN02950 909 4-alpha-glucanotransferase 82.58
PLN03236 745 4-alpha-glucanotransferase; Provisional 82.56
PF14701423 hDGE_amylase: glucanotransferase domain of human g 82.0
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 81.72
PRK09936296 hypothetical protein; Provisional 81.07
KOG3625 1521 consensus Alpha amylase [Carbohydrate transport an 80.81
PF07488328 Glyco_hydro_67M: Glycosyl hydrolase family 67 midd 80.3
PLN03059 840 beta-galactosidase; Provisional 80.28
>PLN02361 alpha-amylase Back     alignment and domain information
Probab=100.00  E-value=1.8e-64  Score=482.43  Aligned_cols=291  Identities=86%  Similarity=1.459  Sum_probs=256.3

Q ss_pred             ccCCceeEEEEeeCCCCCCchHHHHHHhhhHHHHcCCCEEEeCCCCCCCCCCCCCcccCCCcCCCCCCHHHHHHHHHHHh
Q 021281           21 IRNGREILFQGFNWESCKHDWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLNSSYGSEHLLKALLHKMK  100 (314)
Q Consensus        21 ~~~~~~~i~q~F~w~~~~~g~~~gi~~~ldyl~~lG~~~I~l~Pi~~~~~~~gY~~~d~~~id~~~Gt~~df~~lv~~ah  100 (314)
                      ...|++||||+|+|++++..+|++|+++|+||++||||+|||+|++++.++|||+|.|||+|+|+|||++||++||++||
T Consensus         7 ~~~~~~v~lQ~F~W~~~~~~~w~~i~~kl~~l~~lG~t~iwl~P~~~~~~~~GY~~~d~y~~~~~~Gt~~el~~li~~~h   86 (401)
T PLN02361          7 IRNGREILLQAFNWESHKHDWWRNLEGKVPDLAKSGFTSAWLPPPSQSLAPEGYLPQNLYSLNSAYGSEHLLKSLLRKMK   86 (401)
T ss_pred             hcCCCcEEEEEEeccCCccHHHHHHHHHHHHHHHcCCCEEEeCCCCcCCCCCCCCcccccccCcccCCHHHHHHHHHHHH
Confidence            44568999999999998777999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hCCCEEEEeeeeccccCCCCCCCCcCcCCCCCCCCCCCCCcccCCCCCccccCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q 021281          101 QHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVTSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRW  180 (314)
Q Consensus       101 ~~Gi~VilD~V~NH~~~~~~~~~~~y~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~~p~v~~~l~~~~~~  180 (314)
                      ++||+||+|+|+||++...++..++|..|.+.+.+|.+..++....+.++...+..+.++||||++||+||+++++++++
T Consensus        87 ~~gi~vi~D~V~NH~~g~~~~~~~~y~~~~g~~~~wd~~~~~~~~~g~~~~~~~~~~~~lpDLd~~np~Vr~~l~~~~~w  166 (401)
T PLN02361         87 QYNVRAMADIVINHRVGTTQGHGGMYNRYDGIPLPWDEHAVTSCTGGLGNRSTGDNFNGVPNIDHTQHFVRKDIIGWLIW  166 (401)
T ss_pred             HcCCEEEEEEccccccCCCCCCCCCcccCCCCcCCCCccccccccCCCCCccCCCCCccCCccCCCCHHHHHHHHHHHHH
Confidence            99999999999999987766677788877654456766554443334444455667889999999999999999999998


Q ss_pred             HHHhCCCCEEEeccCCCCCHHHHHHHHHhhCCCeEEEcccCCCCCC--CCCCCCccchhHHHHhhhhccCCCcceeeChh
Q 021281          181 LRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYN--SHGLDYNQDSHRQRIINWIDGTGQLSAAFDFT  258 (314)
Q Consensus       181 w~~~~gvDGfRlDaa~~i~~~f~~~~~~~~~~~~~~gE~~~~~~y~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~df~  258 (314)
                      |++++||||||+|+|||++.+||++++++++|.|+|||+|++..+.  ++.++|.++++++.+..|++.+++..++|||+
T Consensus       167 l~~~~GiDGfRlDavk~~~~~f~~~~~~~~~p~f~VGE~w~~~~~~~~d~~~~y~~~~~~~~l~~~~~~~~~~~~~fDF~  246 (401)
T PLN02361        167 LRNDVGFQDFRFDFAKGYSAKFVKEYIEAAKPLFSVGEYWDSCNYSGPDYRLDYNQDSHRQRIVNWIDGTGGLSAAFDFT  246 (401)
T ss_pred             HHhcCCCCEEEEeccccCCHHHHHHHHHhhCCeEEEEEEecCCCcCCcccccchhhhhHHHHHHHHHHhcCCcceeecHH
Confidence            8867999999999999999999999999999999999999985543  45588888888899999999887789999999


Q ss_pred             hHHHHHHHHccchhHHHhhhCCCCCCccccCCceeeccCCCCCCCCCCCCCCC
Q 021281          259 TKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHDYR  311 (314)
Q Consensus       259 l~~~l~~~~~g~~~~l~~~~~~~~~~~~~~p~~~v~F~~NHD~~R~~~~~~~~  311 (314)
                      +...+++++.++.+++.+..++++++++..|.++||||+||||+|.+++||.+
T Consensus       247 l~~~l~~a~~~~~~~l~~~~~~~~~~~~~~p~~aVTFvdNHDt~r~~~~~~~~  299 (401)
T PLN02361        247 TKGILQEAVKGQWWRLRDAQGKPPGVMGWWPSRAVTFIDNHDTGSTQAHWPFP  299 (401)
T ss_pred             HHHHHHHHHhhhHHHHhhhhcCCcchhhcChhhceEecccCcCcchhhccCCc
Confidence            99999999977788888887766677888899999999999999999998764



>PLN02784 alpha-amylase Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK13840 sucrose phosphorylase; Provisional Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR03852 sucrose_gtfA sucrose phosphorylase Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>KOG2212 consensus Alpha-amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0471 consensus Alpha-amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PF14872 GHL5: Hypothetical glycoside hydrolase 5 Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG3625 consensus Alpha amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06597 GH31_transferase_CtsY CtsY (cyclic tetrasaccharide-synthesizing enzyme Y) is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ Back     alignment and domain information
>PRK14582 pgaB outer membrane N-deacetylase; Provisional Back     alignment and domain information
>PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A Back     alignment and domain information
>cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate Back     alignment and domain information
>cd06600 GH31_MGAM-like This family includes the following closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), lysosomal acid alpha-glucosidase (GAA), neutral alpha-glucosidase C (GANC), the alpha subunit of neutral alpha-glucosidase AB (GANAB), and alpha-glucosidase II Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK10658 putative alpha-glucosidase; Provisional Back     alignment and domain information
>PRK10426 alpha-glucosidase; Provisional Back     alignment and domain information
>cd06602 GH31_MGAM_SI_GAA This family includes the following three closely related glycosyl hydrolase family 31 (GH31) enzymes: maltase-glucoamylase (MGAM), sucrase-isomaltase (SI), and lysosomal acid alpha-glucosidase (GAA), also known as acid-maltase Back     alignment and domain information
>cd06598 GH31_transferase_CtsZ CtsZ (cyclic tetrasaccharide-synthesizing enzyme Z) is a bacterial 6-alpha-glucosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsY Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06604 GH31_glucosidase_II_MalA Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities Back     alignment and domain information
>PLN02635 disproportionating enzyme Back     alignment and domain information
>cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>COG1501 Alpha-glucosidases, family 31 of glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02446 Glyco_hydro_77: 4-alpha-glucanotransferase; InterPro: IPR003385 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK14508 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>KOG1065 consensus Maltase glucoamylase and related hydrolases, glycosyl hydrolase family 31 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02763 hydrolase, hydrolyzing O-glycosyl compounds Back     alignment and domain information
>PLN03236 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>cd06595 GH31_xylosidase_XylS-like This family represents an uncharacterized glycosyl hydrolase family 31 (GH31) enzyme found in bacteria and eukaryotes that is related to the XylS xylosidase of Sulfolobus solfataricus Back     alignment and domain information
>TIGR01531 glyc_debranch glycogen debranching enzymye Back     alignment and domain information
>PLN02635 disproportionating enzyme Back     alignment and domain information
>smart00812 Alpha_L_fucos Alpha-L-fucosidase Back     alignment and domain information
>TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06601 GH31_lyase_GLase GLases (alpha-1,4-glucan lyases) are glycosyl hydrolase family 31 (GH31) enzymes that degrade alpha-1,4-glucans and maltooligosaccharides via a nonhydrolytic pathway to yield 1,5-D-anhydrofructose from the nonreducing end Back     alignment and domain information
>cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas Back     alignment and domain information
>PRK11052 malQ 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>PRK14508 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 Back     alignment and domain information
>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
>cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes Back     alignment and domain information
>PRK11052 malQ 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>cd06603 GH31_GANC_GANAB_alpha This family includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB) Back     alignment and domain information
>PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>cd06589 GH31 The enzymes of glycosyl hydrolase family 31 (GH31) occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase Back     alignment and domain information
>TIGR00217 malQ 4-alpha-glucanotransferase Back     alignment and domain information
>cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07555 NAGidase: beta-N-acetylglucosaminidase ; InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 Back     alignment and domain information
>cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>PRK15447 putative protease; Provisional Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2342 Predicted extracellular endo alpha-1,4 polygalactosaminidase or related polysaccharide hydrolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02446 Glyco_hydro_77: 4-alpha-glucanotransferase; InterPro: IPR003385 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>PLN03236 4-alpha-glucanotransferase; Provisional Back     alignment and domain information
>PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>PRK09936 hypothetical protein; Provisional Back     alignment and domain information
>KOG3625 consensus Alpha amylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07488 Glyco_hydro_67M: Glycosyl hydrolase family 67 middle domain; InterPro: IPR011100 Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
1ava_A403 Amy2BASI PROTEIN-Protein Complex From Barley Seed L 3e-72
3bsg_A 414 Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant 8e-72
1ht6_A405 Crystal Structure At 1.5a Resolution Of The Barley 1e-71
2qps_A405 "sugar Tongs" Mutant Y380a In Complex With Acarbose 1e-71
2qpu_A405 Sugar Tongs Mutant S378p In Complex With Acarbose L 1e-71
3bsh_A 414 Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant 5e-71
1rp8_A405 Crystal Structure Of Barley Alpha-Amylase Isozyme 1 7e-71
3qgv_A 435 Crystal Structure Of A Thermostable Amylase Variant 1e-16
1mwo_A 435 Crystal Structure Analysis Of The Hyperthermostable 1e-16
3bc9_A 599 Alpha-Amylase B In Complex With Acarbose Length = 5 3e-15
2amg_A 418 Structure Of Hydrolase (Glycosidase) Length = 418 5e-15
1gcy_A 527 High Resolution Crystal Structure Of Maltotetraose- 6e-15
1jda_A 429 Maltotetraose-Forming Exo-Amylase Length = 429 1e-14
1qi3_A 429 Mutant (D193n) Maltotetraose-Forming Exo-Amylase In 2e-14
1qi5_A 429 Mutant (D294n) Maltotetraose-Forming Exo-Amylase In 2e-14
1qpk_A 418 Mutant (D193g) Maltotetraose-Forming Exo-Amylase In 3e-14
1qi4_A 429 Mutant (e219g) Maltotetraose-forming Exo-amylase In 4e-14
3bh4_A 483 High Resolution Crystal Structure Of Bacillus Amylo 5e-11
1e3x_A 483 Native Structure Of Chimaeric Amylase From B. Amylo 7e-11
2guy_A 478 Orthorhombic Crystal Structure (Space Group P21212) 4e-10
2taa_A 478 Structure And Possible Catalytic Residues Of Taka-A 2e-09
1vjs_A 483 Structure Of Alpha-Amylase Precursor Length = 483 5e-08
1bli_A 483 Bacillus Licheniformis Alpha-Amylase Length = 483 1e-07
1ob0_A 483 Kinetic Stabilization Of Bacillus Licheniformis-Amy 2e-07
1ud2_A 480 Crystal Structure Of Calcium-Free Alpha-Amylase Fro 2e-07
1ud3_A 480 Crystal Structure Of Amyk38 N289h Mutant Length = 4 2e-07
1hvx_A 515 Bacillus Stearothermophilus Alpha-Amylase Length = 2e-07
2aaa_A 484 Calcium Binding In Alpha-Amylases: An X-Ray Diffrac 7e-07
1w9x_A 481 Bacillus Halmapalus Alpha Amylase Length = 481 1e-06
2gjp_A 485 Structure Of Bacillus Halmapalus Alpha-Amylase, Cry 2e-06
1wza_A 488 Crystal Structure Of Alpha-Amylase From H.Orenii Le 1e-05
1bpl_A189 Glycosyltransferase Length = 189 4e-05
1wp6_A 485 Crystal Structure Of Maltohexaose-producing Amylase 6e-05
1wp6_A 485 Crystal Structure Of Maltohexaose-producing Amylase 6e-04
2die_A 485 Alkaline Alpha-Amylase Amyk From Bacillus Sp. Ksm-1 1e-04
1lwh_A 441 Crystal Structure Of T. Maritima 4-Alpha-Glucanotra 2e-04
2ya1_A 1014 Product Complex Of A Multi-Modular Glycogen-Degradi 4e-04
2ya2_A 708 Catalytic Module Of The Multi-Modular Glycogen-Degr 4e-04
2ya0_A 714 Catalytic Module Of The Multi-Modular Glycogen-Degr 4e-04
4aie_A 549 Structure Of Glucan-1,6-Alpha-Glucosidase From Lact 6e-04
>pdb|1AVA|A Chain A, Amy2BASI PROTEIN-Protein Complex From Barley Seed Length = 403 Back     alignment and structure

Iteration: 1

Score = 268 bits (685), Expect = 3e-72, Method: Compositional matrix adjust. Identities = 141/294 (47%), Positives = 187/294 (63%), Gaps = 14/294 (4%) Query: 26 EILFQGFNWESCKHD--WWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLN 83 ++LFQGFNWES KH+ W+ L KV DI+ +G T VWLPPA+ S A +GY+P LY L+ Sbjct: 1 QVLFQGFNWESWKHNGGWYNFLMGKVDDIAAAGITHVWLPPASQSVAEQGYMPGRLYDLD 60 Query: 84 SS-YGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDG----IPLSWDE 138 +S YG++ LK+L+ + V+A+ADIVINHR + G Y ++G L W Sbjct: 61 ASKYGNKAQLKSLIGALHGKGVKAIADIVINHRTAEHKDGRGIYCIFEGGTPDARLDWGP 120 Query: 139 HAVT----SCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDF 194 H + G GN TG +F P+IDH V+K+++ WL WL+ +GF +RFDF Sbjct: 121 HMICRDDRPYADGTGNPDTGADFGAAPDIDHLNLRVQKELVEWLNWLKADIGFDGWRFDF 180 Query: 195 ARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGL-DYNQDSHRQRIINWIDGTGQLSA 253 A+GYSA K YI+ + P F+V E W S Y G + NQD HRQ ++NW+D G Sbjct: 181 AKGYSADVAKIYIDRSEPSFAVAEIWTSLAYGGDGKPNLNQDQHRQELVNWVDKVGGKGP 240 Query: 254 A--FDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQ 305 A FDFTTKGIL AV+G+ WRLR GK PG++GWWP++AVTF+DNHDTGSTQ Sbjct: 241 ATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGWWPAKAVTFVDNHDTGSTQ 294
>pdb|3BSG|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) H395a Mutant Length = 414 Back     alignment and structure
>pdb|1HT6|A Chain A, Crystal Structure At 1.5a Resolution Of The Barley Alpha- Amylase Isozyme 1 Length = 405 Back     alignment and structure
>pdb|2QPS|A Chain A, "sugar Tongs" Mutant Y380a In Complex With Acarbose Length = 405 Back     alignment and structure
>pdb|2QPU|A Chain A, Sugar Tongs Mutant S378p In Complex With Acarbose Length = 405 Back     alignment and structure
>pdb|3BSH|A Chain A, Barley Alpha-Amylase Isozyme 1 (Amy1) Double Mutant Y105aY380A IN COMPLEX WITH INHIBITOR ACARBOSE Length = 414 Back     alignment and structure
>pdb|1RP8|A Chain A, Crystal Structure Of Barley Alpha-Amylase Isozyme 1 (Amy1) Inactive Mutant D180a In Complex With Maltoheptaose Length = 405 Back     alignment and structure
>pdb|3QGV|A Chain A, Crystal Structure Of A Thermostable Amylase Variant Length = 435 Back     alignment and structure
>pdb|1MWO|A Chain A, Crystal Structure Analysis Of The Hyperthermostable Pyrocoocus Woesei Alpha-Amylase Length = 435 Back     alignment and structure
>pdb|3BC9|A Chain A, Alpha-Amylase B In Complex With Acarbose Length = 599 Back     alignment and structure
>pdb|2AMG|A Chain A, Structure Of Hydrolase (Glycosidase) Length = 418 Back     alignment and structure
>pdb|1GCY|A Chain A, High Resolution Crystal Structure Of Maltotetraose-Forming Exo-Amylase Length = 527 Back     alignment and structure
>pdb|1JDA|A Chain A, Maltotetraose-Forming Exo-Amylase Length = 429 Back     alignment and structure
>pdb|1QI3|A Chain A, Mutant (D193n) Maltotetraose-Forming Exo-Amylase In Complex With Maltotetraose Length = 429 Back     alignment and structure
>pdb|1QI5|A Chain A, Mutant (D294n) Maltotetraose-Forming Exo-Amylase In Complex With Maltotetraose Length = 429 Back     alignment and structure
>pdb|1QPK|A Chain A, Mutant (D193g) Maltotetraose-Forming Exo-Amylase In Complex With Maltotetraose Length = 418 Back     alignment and structure
>pdb|1QI4|A Chain A, Mutant (e219g) Maltotetraose-forming Exo-amylase In Complex With Maltotetraose Length = 429 Back     alignment and structure
>pdb|3BH4|A Chain A, High Resolution Crystal Structure Of Bacillus Amyloliquefaciens Alpha-Amylase Length = 483 Back     alignment and structure
>pdb|1E3X|A Chain A, Native Structure Of Chimaeric Amylase From B. Amyloliquefaciens And B. Licheniformis At 1.92a Length = 483 Back     alignment and structure
>pdb|2GUY|A Chain A, Orthorhombic Crystal Structure (Space Group P21212) Of Aspergillus Niger Alpha-Amylase At 1.6 A Resolution Length = 478 Back     alignment and structure
>pdb|2TAA|A Chain A, Structure And Possible Catalytic Residues Of Taka-Amylase A Length = 478 Back     alignment and structure
>pdb|1VJS|A Chain A, Structure Of Alpha-Amylase Precursor Length = 483 Back     alignment and structure
>pdb|1BLI|A Chain A, Bacillus Licheniformis Alpha-Amylase Length = 483 Back     alignment and structure
>pdb|1OB0|A Chain A, Kinetic Stabilization Of Bacillus Licheniformis-Amylase Through Introduction Of Hydrophobic Residues At The Surface Length = 483 Back     alignment and structure
>pdb|1UD2|A Chain A, Crystal Structure Of Calcium-Free Alpha-Amylase From Bacillus Sp. Strain Ksm-K38 (Amyk38) Length = 480 Back     alignment and structure
>pdb|1UD3|A Chain A, Crystal Structure Of Amyk38 N289h Mutant Length = 480 Back     alignment and structure
>pdb|1HVX|A Chain A, Bacillus Stearothermophilus Alpha-Amylase Length = 515 Back     alignment and structure
>pdb|2AAA|A Chain A, Calcium Binding In Alpha-Amylases: An X-Ray Diffraction Study At 2.1 Angstroms Resolution Of Two Enzymes From Aspergillus Length = 484 Back     alignment and structure
>pdb|1W9X|A Chain A, Bacillus Halmapalus Alpha Amylase Length = 481 Back     alignment and structure
>pdb|2GJP|A Chain A, Structure Of Bacillus Halmapalus Alpha-Amylase, Crystallized With The Substrate Analogue Acarbose And Maltose Length = 485 Back     alignment and structure
>pdb|1WZA|A Chain A, Crystal Structure Of Alpha-Amylase From H.Orenii Length = 488 Back     alignment and structure
>pdb|1BPL|A Chain A, Glycosyltransferase Length = 189 Back     alignment and structure
>pdb|1WP6|A Chain A, Crystal Structure Of Maltohexaose-producing Amylase From Alkalophilic Bacillus Sp.707. Length = 485 Back     alignment and structure
>pdb|1WP6|A Chain A, Crystal Structure Of Maltohexaose-producing Amylase From Alkalophilic Bacillus Sp.707. Length = 485 Back     alignment and structure
>pdb|2DIE|A Chain A, Alkaline Alpha-Amylase Amyk From Bacillus Sp. Ksm-1378 Length = 485 Back     alignment and structure
>pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-Glucanotransferase Length = 441 Back     alignment and structure
>pdb|2YA1|A Chain A, Product Complex Of A Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 1014 Back     alignment and structure
>pdb|2YA2|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua In Complex With An Inhibitor Length = 708 Back     alignment and structure
>pdb|2YA0|A Chain A, Catalytic Module Of The Multi-Modular Glycogen-Degrading Pneumococcal Virulence Factor Spua Length = 714 Back     alignment and structure
>pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 4e-98
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 3e-77
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 4e-66
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 4e-64
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 5e-55
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 1e-54
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 8e-51
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 2e-40
1hx0_A 496 Alpha amylase (PPA); inhibitor, carbohydrate, panc 4e-33
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 4e-22
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 7e-19
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 1e-17
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 3e-14
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 3e-17
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 6e-17
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 4e-15
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 1e-14
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 3e-14
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 6e-14
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 9e-14
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 2e-11
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 7e-09
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 3e-05
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 1e-08
3klk_A1039 Glucansucrase; native form, open conformation, mul 1e-08
3klk_A 1039 Glucansucrase; native form, open conformation, mul 3e-05
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 9e-08
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 2e-07
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 9e-07
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 2e-06
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 5e-06
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 2e-05
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 1e-04
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 2e-04
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 2e-04
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 2e-04
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 4e-04
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 Back     alignment and structure
 Score =  293 bits (753), Expect = 4e-98
 Identities = 136/295 (46%), Positives = 185/295 (62%), Gaps = 15/295 (5%)

Query: 26  EILFQGFNWESCKHD--WWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLN 83
           ++LFQGFNWES K    W+  +  KV DI+ +G T VWLPP +HS + EGY+P  LY ++
Sbjct: 2   QVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDID 61

Query: 84  SS-YGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLS----WDE 138
           +S YG+   LK+L+  +    V+A+ADIVINHR    +   G Y  ++G        W  
Sbjct: 62  ASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGP 121

Query: 139 HAV----TSCTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDF 194
           H +    T  + G  N  TG +F   P+IDH    V++++  WL WL++ +GF  +R DF
Sbjct: 122 HMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDF 181

Query: 195 ARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHG-LDYNQDSHRQRIINWIDGTGQLS- 252
           ARGYS +  K YI+G  P  +V E WD+      G  +Y+QD+HRQ ++NW+D  G  + 
Sbjct: 182 ARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAAS 241

Query: 253 --AAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQ 305
               FDFTTKGIL  AV+G+ WRL D QGK PGVMGWWP++AVTF+DNHDTGSTQ
Sbjct: 242 AGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQ 296


>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Length = 435 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 Back     alignment and structure
>1hx0_A Alpha amylase (PPA); inhibitor, carbohydrate, pancreas, hydrolase; HET: GLC AC1 BGC MAL; 1.38A {Sus scrofa} SCOP: b.71.1.1 c.1.8.1 PDB: 1wo2_A* 1ua3_A* 1kxq_A 1kxt_A 1kxv_A 1jfh_A* 1vah_A* 1ppi_A* 3l2m_A* 3l2l_A* 1dhk_A* 1ose_A* 1pig_A* 1pif_A* 1bvn_P 3oli_A* 3old_A* 3olg_A* 3ole_A* 3ij8_A* ... Length = 496 Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Length = 448 Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Length = 844 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Length = 471 Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Length = 1108 Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* Length = 1039 Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* Length = 1039 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 100.0
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 100.0
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 100.0
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 100.0
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 100.0
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 100.0
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 100.0
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 100.0
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 100.0
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 100.0
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 100.0
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 100.0
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 100.0
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 100.0
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 100.0
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 100.0
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 100.0
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 100.0
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 100.0
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 100.0
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 100.0
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 100.0
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 100.0
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 100.0
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 100.0
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 100.0
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 100.0
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 100.0
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 100.0
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 100.0
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 100.0
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 100.0
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 100.0
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 100.0
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 100.0
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 100.0
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 100.0
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 100.0
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 100.0
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 100.0
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 100.0
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 100.0
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 100.0
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 100.0
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 100.0
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 100.0
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 100.0
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 100.0
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 100.0
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 100.0
1r7a_A 504 Sucrose phosphorylase; beta-alpha-barrels, dimer, 100.0
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 100.0
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 100.0
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 100.0
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 100.0
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 100.0
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 100.0
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 100.0
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 100.0
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 100.0
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 100.0
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 99.97
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 99.97
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.9
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.88
3klk_A1039 Glucansucrase; native form, open conformation, mul 99.86
3aie_A 844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 99.83
3klk_A 1039 Glucansucrase; native form, open conformation, mul 99.79
3ttq_A 1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 99.14
2yfo_A 720 Alpha-galactosidase-sucrose kinase agask; hydrolas 98.46
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 98.42
2xn2_A 732 Alpha-galactosidase; hydrolase, glycosidase; HET: 98.26
1zy9_A 564 Alpha-galactosidase; TM1192, struc genomics, joint 97.76
4fnq_A 729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 97.56
3vmn_A 643 Dextranase; TIM barrel, immunoglobrin fold, greek- 97.4
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 97.38
2f2h_A 773 Putative family 31 glucosidase YICI; BETA8alpha8 b 96.86
3lpp_A 898 Sucrase-isomaltase; glycoside hydrolase family 31, 96.85
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 96.62
3l4y_A 875 Maltase-glucoamylase, intestinal; glycoside hydrol 96.59
2g3m_A 693 Maltase, alpha-glucosidase; hydrolase, glycoside h 96.36
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 96.18
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 96.12
3cc1_A 433 BH1870 protein, putative alpha-N-acetylgalactosami 96.1
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 96.0
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 95.97
4ba0_A 817 Alpha-glucosidase, putative, ADG31B; hydrolase; HE 95.79
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 95.77
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 95.65
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 95.46
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 95.27
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 95.14
1uuq_A 440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 95.03
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 94.86
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 94.83
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 94.83
1x1n_A 524 4-alpha-glucanotransferase; disproportionating enz 94.8
1tz7_A 505 4-alpha-glucanotransferase; (beta, alpha)8- barrel 94.67
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 94.56
3nsx_A 666 Alpha-glucosidase; structural genomics, PSI-2, pro 94.45
1esw_A 500 Amylomaltase; (beta,alpha)8-barrel, glucanotransfe 94.41
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 94.4
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 94.4
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 94.35
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 94.31
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 94.19
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 94.12
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 94.0
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 93.94
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 93.94
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 93.85
3a24_A641 Alpha-galactosidase; glycoside hydrolase family 97 93.78
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 93.78
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 93.71
2xvl_A 1020 Alpha-xylosidase, putative, XYL31A; hydrolase, gly 93.64
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 93.58
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 93.43
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 93.41
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 93.26
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 93.22
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 93.2
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 93.15
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 93.11
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 93.05
2p0o_A372 Hypothetical protein DUF871; structural genomics, 92.93
4f9d_A618 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; 92.63
1esw_A500 Amylomaltase; (beta,alpha)8-barrel, glucanotransfe 92.49
3eyp_A 469 Putative alpha-L-fucosidase; structural genomics, 92.46
1x7f_A385 Outer surface protein; structural genomics, unknow 92.46
1x1n_A524 4-alpha-glucanotransferase; disproportionating enz 92.43
3gyc_A393 Putative glycoside hydrolase; YP_001304622.1, stru 92.32
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 92.17
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 92.14
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 92.1
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 92.03
3n12_A333 Chitinase A, chinctu2; zinc atoms, complex, hydrol 91.96
2wvv_A 450 Alpha-L-fucosidase; alpha-L-fucose, hydrolase, gly 91.91
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 91.76
2zxd_A 455 Alpha-L-fucosidase, putative; TIM barrel, hydrolas 91.67
4axn_A328 Chitinase C1; hydrolase; 1.68A {Serratia marcescen 91.5
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 91.29
3ebv_A302 Chinitase A; chitinase A, CHIA, glycosidase, struc 91.02
4ac1_X283 Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g 90.85
1tz7_A505 4-alpha-glucanotransferase; (beta, alpha)8- barrel 90.67
2d73_A738 Alpha-glucosidase SUSB; glycoside hydrolase family 90.66
3a21_A 614 Putative secreted alpha-galactosidase; beta-alpha- 90.59
2x2h_A 1027 Alpha-1,4-glucan lyase isozyme 1; anhydrofructose 90.58
3ues_A 478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 89.93
2ki0_A36 DS119; beta-alpha-beta, de novo protein; NMR {Synt 89.89
1uas_A362 Alpha-galactosidase; TIM-barrel, beta-alpha-barrel 89.81
3poh_A451 Endo-beta-N-acetylglucosaminidase F1; TIM barrel, 88.98
3top_A 908 Maltase-glucoamylase, intestinal; membrane, hydrol 88.8
2ebn_A289 Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl 88.14
1eok_A290 Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b 87.79
3a5v_A397 Alpha-galactosidase; beta/alpha barrel, N-glycosyl 87.74
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 87.61
1edt_A271 Endo-beta-N-acetylglucosaminidase H, endo H; hydro 87.32
3kzs_A 463 Glycosyl hydrolase family 5; structural genomics, 87.05
2cho_A 716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 86.98
2xsa_A 447 Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, 86.89
3obe_A305 Sugar phosphate isomerase/epimerase; structural ge 86.47
2y8v_A290 CHIC, class III chitinase, putative; afchic, hydro 85.66
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 85.5
3d3a_A 612 Beta-galactosidase; protein structure initiative I 85.43
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 84.37
1now_A507 Beta-hexosaminidase beta chain; (beta/alpha)8-barr 84.03
2aam_A309 Hypothetical protein TM1410; structural genomics, 83.97
3ian_A321 Chitinase; structural genomics, hydrolase, glycosi 83.7
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 83.26
3fnd_A312 Chitinase; TIM-barrel, structural genomics, PSI-2, 82.48
2gjx_A507 Beta-hexosaminidase alpha chain; beta-hexosaminida 82.13
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 82.08
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 81.11
1jak_A512 Beta-N-acetylhexosaminidase; glycoside hydrolase, 81.06
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 80.3
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
Probab=100.00  E-value=6.5e-57  Score=433.98  Aligned_cols=285  Identities=47%  Similarity=0.936  Sum_probs=229.4

Q ss_pred             ceeEEEEeeCCCCCC--chHHHHHHhhhHHHHcCCCEEEeCCCCCCCCCCCCCcccCCCcC-CCCCCHHHHHHHHHHHhh
Q 021281           25 REILFQGFNWESCKH--DWWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLN-SSYGSEHLLKALLHKMKQ  101 (314)
Q Consensus        25 ~~~i~q~F~w~~~~~--g~~~gi~~~ldyl~~lG~~~I~l~Pi~~~~~~~gY~~~d~~~id-~~~Gt~~df~~lv~~ah~  101 (314)
                      ++||+|.|+|+++++  |||++|+++|+||++||||+|||+||+++.++|||+|.||++|+ |+|||+++|++||++||+
T Consensus         1 ~~v~~~~F~~d~~~d~~G~~~gi~~~ldyl~~lGv~~i~l~Pi~~~~~~~gY~~~d~~~id~~~~Gt~~d~~~lv~~~h~   80 (405)
T 1ht6_A            1 HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHG   80 (405)
T ss_dssp             CCCEEECCCTTGGGCTTCHHHHHHTTHHHHHHTTCCEEEECCCSCBSSTTSSSBCCTTCGGGCTTCCHHHHHHHHHHHHH
T ss_pred             CccEEEeEEcCCCCCCCcCHHHHHHHHHHHHHcCCCEEEeCCCccCCCCCCCCccccccCCCccCCCHHHHHHHHHHHHH
Confidence            469999999999876  49999999999999999999999999999999999999999999 999999999999999999


Q ss_pred             CCCEEEEeeeeccccCCCCCCCCcCcCCCC----CCCCCCCCCcc----cCCCCCccccCCCCCCCCCCCCCCCHHHHHH
Q 021281          102 HKVRAMADIVINHRVGTTQGHGGKYNRYDG----IPLSWDEHAVT----SCTGGLGNGSTGDNFHGVPNIDHTQHFVRKD  173 (314)
Q Consensus       102 ~Gi~VilD~V~NH~~~~~~~~~~~y~~f~~----~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~dln~~~p~v~~~  173 (314)
                      +||+||+|+|+||++.+++...+.|..|.+    ...+|.+..++    .+.++.+.+..++++.++|+||++||+||++
T Consensus        81 ~Gi~VilD~V~NH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~~p~v~~~  160 (405)
T 1ht6_A           81 KGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRE  160 (405)
T ss_dssp             TTCEEEEEECCSBCCCSEECTTSCEEECCCSSSSSTTCCCGGGBCTTCTTTCCSCSCCCSSCCCTTSCBBCTTCHHHHHH
T ss_pred             CCCEEEEEECcCcccCCCCCCCCCcccCCCCCcCCCCCCCCccccCCCCCcCCCCCcccCCCCcCcCCccCcCCHHHHHH
Confidence            999999999999999988743343433432    12345432111    2334444556678899999999999999999


Q ss_pred             HHHHHHHHHHhCCCCEEEeccCCCCCHHHHHHHHHhhCCCeEEEcccCCCCCC-CCCCCCccchhHHHHhhhhccCCC--
Q 021281          174 IIAWLRWLRNTVGFQDFRFDFARGYSAKYVKEYIEGARPIFSVGEYWDSCNYN-SHGLDYNQDSHRQRIINWIDGTGQ--  250 (314)
Q Consensus       174 l~~~~~~w~~~~gvDGfRlDaa~~i~~~f~~~~~~~~~~~~~~gE~~~~~~y~-~~~~~~~~~~~~~~~~~~~~~~~~--  250 (314)
                      |++++++|++++||||||||+|++++.+||++++++++|.|++||+|....|. ++.++|.+....+.+..|+..+++  
T Consensus       161 i~~~~~~w~~~~gvDGfR~D~~~~~~~~f~~~~~~~~~p~~~igE~~~~~~~~~~~~~~y~~~~~~~~~~~~~~~~g~~~  240 (405)
T 1ht6_A          161 LKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAA  240 (405)
T ss_dssp             HHHHHHHHHHHHCCCEEEETTGGGSCHHHHHHHHHHHCCSCEEECCCCCCCBCTTSSBCSCCHHHHHHHHHHHHHHTGGG
T ss_pred             HHHHHHHHHhccCCCEEEEeccccCCHHHHHHHHHhhCCceEEEEeccCCcccCccccccccchhHHHHHHHHhccCccc
Confidence            99999999977999999999999999999999999999999999999875553 345666543234566777765432  


Q ss_pred             -cceeeChhhHHHHHHHHccchhHHHhhhCCCCCCccccCCceeeccCCCCCCCCCCCCC
Q 021281          251 -LSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHD  309 (314)
Q Consensus       251 -~~~~~df~l~~~l~~~~~g~~~~l~~~~~~~~~~~~~~p~~~v~F~~NHD~~R~~~~~~  309 (314)
                       ..++|||++...+.++++|+.+.+.+.++...++....|..+++|++|||+.|..+.++
T Consensus       241 ~~~~vfdf~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~p~~~~~fl~nHD~~r~~~~~~  300 (405)
T 1ht6_A          241 SAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWP  300 (405)
T ss_dssp             SSEEEECHHHHHHHHHHTTTCGGGGSCTTSSCSSHHHHCGGGEEEESCCTTTSTTTCSSC
T ss_pred             ccceeechhhHHHHHHHHhhhHHHHHhhhcccchhhhcChhhhhhccCCcCCcccccccc
Confidence             35569999999999988766555654433222233445678999999999999887664



>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>2f2h_A Putative family 31 glucosidase YICI; BETA8alpha8 barrel, hydrolase; HET: MPO XTG; 1.95A {Escherichia coli} SCOP: b.150.1.1 b.30.5.11 b.71.1.4 c.1.8.13 PDB: 1xsj_A 1xsi_A 1xsk_A* 1we5_A* Back     alignment and structure
>3lpp_A Sucrase-isomaltase; glycoside hydrolase family 31, alpha-glucosidase membrane, disease mutation, disulfide bond, glycoprotein, glycosidase; HET: NAG BMA MAN KTL; 2.15A {Homo sapiens} PDB: 3lpo_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>3l4y_A Maltase-glucoamylase, intestinal; glycoside hydrolase family 31, cell membrane, disulfide bond, glycoprotein, glycosidase, hydrolase, membrane; HET: NR4 NAG; 1.80A {Homo sapiens} PDB: 3l4u_A* 3l4v_A* 3l4w_A* 3l4x_A* 3l4t_A* 3l4z_A* 2qmj_A* 2qly_A* 3ctt_A* Back     alignment and structure
>2g3m_A Maltase, alpha-glucosidase; hydrolase, glycoside hydrolase family 31, multidomain protein, (beta/alpha)8 barrel, retaining mechanism; 2.55A {Sulfolobus solfataricus} PDB: 2g3n_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>3cc1_A BH1870 protein, putative alpha-N-acetylgalactosaminidase; structural genomic center for structural genomics, JCSG; HET: MSE PGE PG4 P33; 2.00A {Bacillus halodurans c-125} Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ba0_A Alpha-glucosidase, putative, ADG31B; hydrolase; HET: 5GF PGE ARG; 1.85A {Cellvibrio japonicus} PDB: 4b9z_A* 4b9y_A* Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>1x1n_A 4-alpha-glucanotransferase; disproportionating enzyme, amylomaltase, D-enzyme; 1.80A {Solanum tuberosum} SCOP: c.1.8.1 Back     alignment and structure
>1tz7_A 4-alpha-glucanotransferase; (beta, alpha)8- barrel; 2.15A {Aquifex aeolicus} SCOP: c.1.8.1 Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>3nsx_A Alpha-glucosidase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, acarbose; 1.57A {Ruminococcus obeum} PDB: 3ffj_A 3n04_A 3pha_A* 3nuk_A 3nxm_A* 3m46_A 3mkk_A* 3m6d_A* 3nqq_A* 3poc_A* Back     alignment and structure
>1esw_A Amylomaltase; (beta,alpha)8-barrel, glucanotransferase, alpha-amylase FAMI acarbose, transferase; HET: ACR; 1.90A {Thermus aquaticus} SCOP: c.1.8.1 PDB: 1cwy_A* 1fp8_A 1fp9_A 2owc_A* 2oww_A* 2owx_A* 2x1i_A* Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>2xvl_A Alpha-xylosidase, putative, XYL31A; hydrolase, glycosyl hydrolase family 31, (beta/alpha)8 barre; HET: PXN; 2.30A {Cellvibrio japonicus} PDB: 2xvg_A* 2xvk_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>4f9d_A Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; family 4 carbohydrate esterase, TIM barrel, hydrolase, deace carbohydrate/sugar binding; HET: MES; 1.90A {Escherichia coli} PDB: 4f9j_A* Back     alignment and structure
>1esw_A Amylomaltase; (beta,alpha)8-barrel, glucanotransferase, alpha-amylase FAMI acarbose, transferase; HET: ACR; 1.90A {Thermus aquaticus} SCOP: c.1.8.1 PDB: 1cwy_A* 1fp8_A 1fp9_A 2owc_A* 2oww_A* 2owx_A* 2x1i_A* Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>1x1n_A 4-alpha-glucanotransferase; disproportionating enzyme, amylomaltase, D-enzyme; 1.80A {Solanum tuberosum} SCOP: c.1.8.1 Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Back     alignment and structure
>2wvv_A Alpha-L-fucosidase; alpha-L-fucose, hydrolase, glycoside hydrolase family 29; 1.73A {Bacteroides thetaiotaomicron} PDB: 2xii_A* 2xib_A* 2wvv_B 2wvt_A* 2wvu_A* 2wvs_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>2zxd_A Alpha-L-fucosidase, putative; TIM barrel, hydrolase; HET: ZXD; 2.15A {Thermotoga maritima} PDB: 2zwy_A* 2zx5_A* 2zx6_A* 2zx7_A* 2zwz_A* 2zx9_A* 2zxa_A* 2zxb_A* 2zx8_A* 1hl9_A* 1hl8_A* 1odu_A* 2wsp_A* Back     alignment and structure
>4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Back     alignment and structure
>4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} Back     alignment and structure
>1tz7_A 4-alpha-glucanotransferase; (beta, alpha)8- barrel; 2.15A {Aquifex aeolicus} SCOP: c.1.8.1 Back     alignment and structure
>2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* Back     alignment and structure
>3a21_A Putative secreted alpha-galactosidase; beta-alpha-barrel, greek KEY motif, beta-jellyroll, beta-TRE hydrolase; HET: GOL 1PG EPE; 1.51A {Streptomyces avermitilis} PDB: 3a22_A* 3a23_A* Back     alignment and structure
>2x2h_A Alpha-1,4-glucan lyase isozyme 1; anhydrofructose pathway, glycoside hydrolase family 3 starch binding domain; 2.06A {Gracilariopsis lemaneiformis} PDB: 2x2i_A* 2x2j_A* Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>2ki0_A DS119; beta-alpha-beta, de novo protein; NMR {Synthetic} Back     alignment and structure
>1uas_A Alpha-galactosidase; TIM-barrel, beta-alpha-barrel, greek KEY motif, hydrolase; HET: GLA; 1.50A {Oryza sativa} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3top_A Maltase-glucoamylase, intestinal; membrane, hydrolase-hydrolase inhibitor complex; HET: ACR; 2.88A {Homo sapiens} PDB: 3ton_A* Back     alignment and structure
>2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Back     alignment and structure
>1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Back     alignment and structure
>3a5v_A Alpha-galactosidase; beta/alpha barrel, N-glycosylation, hydrolase; HET: MAN NAG BMA 1PG; 2.00A {Umbelopsis vinacea} Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>2xsa_A Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, O-GLCNACASE, glycosyl hydrolase, hydrolase; 2.00A {Oceanicola granulosus} PDB: 2xsb_A* Back     alignment and structure
>3obe_A Sugar phosphate isomerase/epimerase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.70A {Parabacteroides distasonis} Back     alignment and structure
>2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* Back     alignment and structure
>2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 Back     alignment and structure
>3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Back     alignment and structure
>2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 314
d1ht6a2347 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hor 4e-41
d1gcya2357 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan m 3e-36
d1mxga2361 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeo 1e-29
d2d3na2394 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu 2e-24
d1hx0a2403 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus s 9e-23
d1hvxa2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillu 6e-22
d1e43a2393 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera 2e-20
d1jaea2378 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea 4e-20
d1g94a2354 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoa 3e-18
d1ud2a2390 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu 4e-17
d1ua7a2344 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillu 8e-12
d1g5aa2 554 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc 2e-10
d2guya2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 2e-09
d1iv8a2 653 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase 2e-09
d1m53a2 478 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Kle 3e-09
d1wzaa2409 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Haloth 3e-09
d1j0ha3382 c.1.8.1 (A:124-505) Neopullulanase, central domain 1e-08
d2aaaa2381 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergill 1e-08
d3bmva4406 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase 4e-08
d1lwha2391 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Ther 2e-07
d1wzla3382 c.1.8.1 (A:121-502) Maltogenic amylase, central do 3e-07
d1uoka2 479 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus 4e-07
d1bf2a3 475 c.1.8.1 (A:163-637) Isoamylase, central domain {Ps 9e-07
d1h3ga3422 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central d 1e-06
d1ji1a3432 c.1.8.1 (A:123-554) Maltogenic amylase, central do 2e-06
d1m7xa3396 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enz 3e-06
d1eh9a3400 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrol 5e-06
d1qhoa4407 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase 5e-06
d1ea9c3382 c.1.8.1 (C:122-503) Maltogenic amylase, central do 1e-05
d2bhua3 420 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydro 3e-05
d1r7aa2 434 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac 2e-04
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Length = 347 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Plant alpha-amylase
species: Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]
 Score =  144 bits (363), Expect = 4e-41
 Identities = 128/292 (43%), Positives = 174/292 (59%), Gaps = 15/292 (5%)

Query: 26  EILFQGFNWESCKHD--WWRNLERKVPDISKSGFTSVWLPPATHSFAPEGYLPQNLYSLN 83
           ++LFQGFNWES K    W+  +  KV DI+ +G T VWLPP +HS + EGY+P  LY ++
Sbjct: 2   QVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDID 61

Query: 84  SS-YGSEHLLKALLHKMKQHKVRAMADIVINHRVGTTQGHGGKYNRYDGIPLSWDEHAVT 142
           +S YG+   LK+L+  +    V+A+ADIVINHR    +   G Y  ++G           
Sbjct: 62  ASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGP 121

Query: 143 SCTGGLGNG--------STGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDF 194
                             TG +F   P+IDH    V++++  WL WL++ +GF  +R DF
Sbjct: 122 HMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDF 181

Query: 195 ARGYSAKYVKEYIEGARPIFSVGEYWDSCNYNSHGL-DYNQDSHRQRIINWIDGTG---Q 250
           ARGYS +  K YI+G  P  +V E WD+      G  +Y+QD+HRQ ++NW+D  G    
Sbjct: 182 ARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAAS 241

Query: 251 LSAAFDFTTKGILQEAVKGQFWRLRDAQGKPPGVMGWWPSRAVTFLDNHDTG 302
               FDFTTKGIL  AV+G+ WRL D QGK PGVMGWWP++AVTF+DNHDTG
Sbjct: 242 AGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTG 293


>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 403 Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Length = 393 Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Length = 393 Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Length = 354 Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Length = 344 Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Length = 381 Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Length = 478 Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Length = 409 Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 382 Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Length = 381 Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Length = 391 Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Length = 382 Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Length = 479 Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Length = 475 Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Length = 422 Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Length = 432 Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Length = 400 Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 407 Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Length = 382 Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Length = 420 Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 100.0
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 100.0
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 100.0
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 100.0
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 100.0
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 100.0
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 100.0
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 100.0
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 100.0
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 100.0
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 100.0
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 100.0
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 100.0
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 100.0
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 100.0
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 100.0
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 100.0
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 100.0
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 100.0
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 100.0
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 100.0
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 100.0
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 100.0
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 100.0
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 100.0
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 100.0
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 100.0
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 100.0
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 100.0
d1gjwa2572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 99.98
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 99.97
d1x1na1 523 Amylomaltase MalQ {Potato (Solanum tuberosum) [Tax 98.24
d1tz7a1 485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 98.11
d1zy9a2348 Alpha-galactosidase GalA catalytic domain {Thermot 97.93
d2f2ha4338 Putative glucosidase YicI, domain 2 {Escherichia c 97.56
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 97.12
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 97.0
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 96.91
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 96.89
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 96.56
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 95.97
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 95.68
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 95.48
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 95.47
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 95.44
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 95.38
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 95.15
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 95.11
d1eswa_ 500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 94.87
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 94.82
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 94.54
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 94.36
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 94.3
d1hl9a2350 Putative alpha-L-fucosidase, catalytic domain {The 94.2
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 94.04
d1edta_265 Endo-beta-N-acetylglucosaminidase {Streptomyces pl 94.0
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 93.78
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 93.45
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 92.99
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 92.57
d2ebna_285 Endo-beta-N-acetylglucosaminidase {Flavobacterium 92.19
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 91.91
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 91.88
d1eoka_282 Endo-beta-N-acetylglucosaminidase {Flavobacterium 91.72
d1qbaa3 443 Bacterial chitobiase (beta-N-acetylhexosaminidase) 90.91
d2aama1285 Hypothetical protein TM1410 {Thermotoga maritima [ 90.89
d1yhta1344 Dispersin B, DspB {Actinobacillus actinomycetemcom 90.63
d1nowa1353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 90.22
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 89.2
d1eswa_500 Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} 87.81
d2gjxa1362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 87.37
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 86.59
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 86.28
d2choa2310 Glucosaminidase GH84, catalytic domain {Bacteroide 85.95
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 85.61
d1r46a2292 Melibiase {Human (Homo sapiens) [TaxId: 9606]} 85.54
d1vema2 417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 85.52
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 85.1
d1uasa2273 Melibiase {Rice (Oryza sativa) [TaxId: 4530]} 84.79
d2ebfx2219 Dermonecrotic toxin, ToxA {Pasteurella multocida [ 83.74
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 82.42
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 81.99
d2cbia2317 Hyaluronidase catalytic domain {Clostridium perfri 81.48
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 80.56
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Amylase, catalytic domain
domain: Bacterial alpha-amylase
species: Bacillus sp. 707 [TaxId: 1416]
Probab=100.00  E-value=3e-54  Score=409.15  Aligned_cols=273  Identities=25%  Similarity=0.506  Sum_probs=207.4

Q ss_pred             ceeEEEEeeCCCCCCc-hHHHHHHhhhHHHHcCCCEEEeCCCCCCC--CCCCCCcccCC---------CcCCCCCCHHHH
Q 021281           25 REILFQGFNWESCKHD-WWRNLERKVPDISKSGFTSVWLPPATHSF--APEGYLPQNLY---------SLNSSYGSEHLL   92 (314)
Q Consensus        25 ~~~i~q~F~w~~~~~g-~~~gi~~~ldyl~~lG~~~I~l~Pi~~~~--~~~gY~~~d~~---------~id~~~Gt~~df   92 (314)
                      ++||||+|+|++|.+| +|++|+++||||++||||+|||+||+++.  ..+||++.|+|         .|+|+|||++||
T Consensus         2 ~~~~~q~f~w~~~~~g~~~~~i~~kLdyL~~LGv~aIwL~Pi~~~~~~~~~gY~~~~~yd~~~~~~~~~vd~~~Gt~~df   81 (394)
T d2d3na2           2 NGTMMQYFEWYLPNDGNHWNRLNSDASNLKSKGITAVWIPPAWKGASQNDVGYGAYDLYDLGEFNQKGTVRTKYGTRSQL   81 (394)
T ss_dssp             CCCEEECCCTTCCSSSCHHHHHHHHHHHHHHHTCCEEEECCCSEESSTTCCSCSEEETTCSSCSCBTTBSSBTTBCHHHH
T ss_pred             CccEEEEEecccCCCCCcHHHHHHHHHHHHHcCCCEEEECcCccCCCCCCCCCCcccCcccccccccCCcCCCCCCHHHH
Confidence            3699999999999987 89999999999999999999999999775  46788888776         599999999999


Q ss_pred             HHHHHHHhhCCCEEEEeeeeccccCCCCCCC----------------Cc-----CcCCCC---------CC--------C
Q 021281           93 KALLHKMKQHKVRAMADIVINHRVGTTQGHG----------------GK-----YNRYDG---------IP--------L  134 (314)
Q Consensus        93 ~~lv~~ah~~Gi~VilD~V~NH~~~~~~~~~----------------~~-----y~~f~~---------~~--------~  134 (314)
                      ++||++||++|||||+|+|+||+|..+....                +.     |..+..         ..        .
T Consensus        82 ~~Lv~~aH~~GIkVilDvV~NH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (394)
T d2d3na2          82 QAAVTSLKNNGIQVYGDVVMNHKGGADATEMVRAVEVNPNNRNQEVTGEYTIEAWTRFDFPGRGNTHSSFKWRWYHFDGV  161 (394)
T ss_dssp             HHHHHHHHHTTCEEEEEECCSEECSCSEEEEEEEEEEETTEEEEECSCCEEEEEEEEBCCTTTTTSSCCCCBCGGGEEEE
T ss_pred             HHHHHHHHHCCCEEEEEEecccccCccccccccccccCcccccccccccccccccccccCccccCCCCccccccccCCCc
Confidence            9999999999999999999999997653100                00     000000         00        0


Q ss_pred             CCCCCC-----ccc-------CCCCCccccCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHhCCCCEEEeccCCCCCHHH
Q 021281          135 SWDEHA-----VTS-------CTGGLGNGSTGDNFHGVPNIDHTQHFVRKDIIAWLRWLRNTVGFQDFRFDFARGYSAKY  202 (314)
Q Consensus       135 ~~~~~~-----~~~-------~~~~~~~~~~~~~~~~~~dln~~~p~v~~~l~~~~~~w~~~~gvDGfRlDaa~~i~~~f  202 (314)
                      +|....     .+.       +..........+.+..+||||++||+||+++++++++|++++||||||+|+|+|++.+|
T Consensus       162 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~dln~~np~V~~~~~~~~~~w~~~~giDGfR~D~a~~~~~~~  241 (394)
T d2d3na2         162 DWDQSRRLNNRIYKFRGHGKAWDWEVDTENGNYDYLMYADIDMDHPEVVNELRNWGVWYTNTLGLDGFRIDAVKHIKYSF  241 (394)
T ss_dssp             SCCTTTCCSSCEEEECSTTCCCCSSCCCTTSCCCCCSSEEECTTCHHHHHHHHHHHHHHHHHHTCSEEEETTGGGSCHHH
T ss_pred             ccccccCCCCCcceecCCCCccccccccccccccccCCcccccCCHHHHHHHHHhhhhhhcccCcceEEecccccCChHH
Confidence            111000     000       00000112234467789999999999999999999999988999999999999999999


Q ss_pred             HHHHHHhhC-----CCeEEEcccCCCCCCCCCCCCccchhHHHHhhhhccCCCcceeeChhhHHHHHHHHc-cchhHHHh
Q 021281          203 VKEYIEGAR-----PIFSVGEYWDSCNYNSHGLDYNQDSHRQRIINWIDGTGQLSAAFDFTTKGILQEAVK-GQFWRLRD  276 (314)
Q Consensus       203 ~~~~~~~~~-----~~~~~gE~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~df~l~~~l~~~~~-g~~~~l~~  276 (314)
                      |++++++++     +.+++||+|...              ...+..|....+...++|||++...++++++ +..+++.+
T Consensus       242 ~~~~~~~~~~~~~~~~~~~gE~~~~~--------------~~~~~~~~~~~~~~~~~~df~~~~~l~~~~~~~~~~~l~~  307 (394)
T d2d3na2         242 TRDWINHVRSATGKNMFAVAEFWKND--------------LGAIENYLQKTNWNHSVFDVPLHYNLYNASKSGGNYDMRN  307 (394)
T ss_dssp             HHHHHHHHHHHHTCCCEEEECCCCSC--------------HHHHHHHHHHTTTCSEEECHHHHHHHHHHHHTTTCSCGGG
T ss_pred             HHHHHHHHHHhcCCceeecccccccc--------------cccccchhccccccceeehHHHHHHHHHHHhcCcchhHHH
Confidence            999887653     478899999862              3455667666666789999999999999984 34455655


Q ss_pred             hhCCCCCCccccCCceeeccCCCCCCCCCCCCCCCCC
Q 021281          277 AQGKPPGVMGWWPSRAVTFLDNHDTGSTQVPHDYRLK  313 (314)
Q Consensus       277 ~~~~~~~~~~~~p~~~v~F~~NHD~~R~~~~~~~~~~  313 (314)
                      .+..  ......|.++|+||+|||++|..+.....+.
T Consensus       308 ~~~~--~~~~~~~~~~v~fl~NHD~~r~~~~~~~~~~  342 (394)
T d2d3na2         308 IFNG--TVVQRHPSHAVTFVDNHDSQPEEALESFVEE  342 (394)
T ss_dssp             TTTT--CHHHHCGGGEEECSCCTTTSTTSTTCCCCCT
T ss_pred             HHhc--cccccCHhHeeEeCcCCcCccccccccCccH
Confidence            5442  2234467789999999999998887665543



>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x1na1 c.1.8.1 (A:2-524) Amylomaltase MalQ {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1hl9a2 c.1.8.11 (A:7-356) Putative alpha-L-fucosidase, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Back     information, alignment and structure
>d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} Back     information, alignment and structure
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1eswa_ c.1.8.1 (A:) Amylomaltase MalQ {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2choa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r46a2 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uasa2 c.1.8.1 (A:1-273) Melibiase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2ebfx2 c.150.1.2 (X:875-1093) Dermonecrotic toxin, ToxA {Pasteurella multocida [TaxId: 747]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cbia2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure