Citrus Sinensis ID: 021301

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MSSVLNTVLSTRLSNVKSTNRVRTRPVLSPVSVSFSRRRLTVRAQEPNANEVKPQAPDKAPAASGSSFNQLLGIKGAAQETNKWKIRLQLTKPVTWPPLIWGIVCGAAASGNFHWNLEDVAKSIVCMIMSGPCLTGYTQTINDWYDREIDAINEPYRPIPSGAISENEVITQIWVLLLAGLGLAGLLDVWAGHDFPTIFWLAVGGSLLSYIYSAPPLKLKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEGDRAMGLQSLPVAFGPETAKWICVGAIDITQISVAGK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccEEccHHHHHHHHHHHHHHHHHHHHcc
*****************************************************************************AQETNKWKIRLQLTKPVTWPPLIWGIVCGAAASGNFHWNLEDVAKSIVCMIMSGPCLTGYTQTINDWYDREIDAINEPYRPIPSGAISENEVITQIWVLLLAGLGLAGLLDVWAGHDFPTIFWLAVGGSLLSYIYSAPPLKLKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEGDRAMGLQSLPVAFGPETAKWICVGAIDITQISVAGK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSVLNTVLSTRLSNVKSTNRVRTRPVLSPVSVSFSRRRLTVRAQEPNANEVKPQAPDKAPAASGSSFNQLLGIKGAAQETNKWKIRLQLTKPVTWPPLIWGIVCGAAASGNFHWNLEDVAKSIVCMIMSGPCLTGYTQTINDWYDREIDAINEPYRPIPSGAISENEVITQIWVLLLAGLGLAGLLDVWAGHDFPTIFWLAVGGSLLSYIYSAPPLKLKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEGDRAMGLQSLPVAFGPETAKWICVGAIDITQISVAGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chlorophyll synthase, chloroplastic Involved in one of the last steps of the biosynthesis of chlorophyll a. Catalyzes the esterification of chlorophillide a or b with a preference for geranylgeranyldiphosphate (GGPP) rather than for phytyldiphosphate (PhyPP).confidentQ38833
Chlorophyll synthase, chloroplastic Involved in one of the last steps of the biosynthesis of chlorophyll a.probableQ5W6H5
Chlorophyll synthase, chloroplastic Involved in one of the last steps of the biosynthesis of chlorophyll a. Catalyzes the esterification of chlorophillide a with either geranylgeranyldiphosphate (GGPP) or phytyldiphosphate (PhyPP). May also use with a lower efficiency the monophosphates GGMP and PhyMP, but not the non-phosphorylated alcohols geranylgeraniol and phytol. The tetraprenyl diphosphate must bind to the enzyme as the first substrate and esterification occurs when this pre-loaded enzyme meets the second substrate, chlorophyllide.probableQ9M3W5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.62Chlorophyll synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QZV, chain F
Confidence level:probable
Coverage over the Query: 38-80
View the alignment between query and template
View the model in PyMOL