Citrus Sinensis ID: 021304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MASNNFFLPASVTSSGRPVLVPNEVECNLLSNVDIEHDQDDAVSFPPLKSGHFILTTHRLLFLSSSCSSTAVAIPLSAITHIFSSKRSLKSVFHSPRFRFQVSATPDNRIFDSDPGRVTGLRSVVITVVVRGKGDWELFLSKMWECWRGRAWAWETTPSETGPASASASASLYASDGSVRMVGVGGLLRKEQEMWESTDRSLQEAFQDLNALMNKAKEMVMLAEKMRQKLLAGSSSQSNSANDEELGSKEEMQDWLLSVGIVSPVTKESAGALYHQQLSRQLADFVKIPLERAGGMINLIDVYCLFNRARGTVR
ccccccccccccccccccECcccccEEEECcccEEEEccccccccccccccEEEEEEEEEEEEEccccccEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHcccccc
***NNFFLPASVTSSGRPVLVPNEVECNLLSNVDIEHDQDDAVSFPPLKSGHFILTTHRLLFLSSSCSSTAVAIPLSAITHIFSSKRSLKSVFHSPRFRFQVSATP********PGR*TGLRSVVITVVVRGKGDWELFLSKMWECWRGRAWAWE************************RMVGVGGLL****************AFQDLNALMNKAKEMVMLA******************************DWLLSVGIVSPVTKESAGALYHQQLSRQLADFVKIPLERAGGMINLIDVYCLFNRARGT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASNNFFLPASVTSSGRPVLVPNEVECNLLSNVDIEHDQDDAVSFPPLKSGHFILTTHRLLFLSSSCSSTAVAIPLSAITHIFSSKRSLKSVFHSPRFRFQVSATPDNRIFDSDPGRVTGLRSVVITVVVRGKGDWELFLSKMWECWRGRAWAWETTPSETGPASASASASLYASDGSVRMVGVGGLLRKEQEMWESTDRSLQEAFQDxxxxxxxxxxxxxxxxxxxxxLLAGSSSQSNSANDEELGSKEEMQDWLLSVGIVSPVTKESAGALYHQQLSRQLADFVKIPLERAGGMINLIDVYCLFNRARGTVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 36 Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.probableQ9FF81

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CUQ, chain B
Confidence level:very confident
Coverage over the Query: 200-229,243-312
View the alignment between query and template
View the model in PyMOL
Template: 1W7P, chain D
Confidence level:very confident
Coverage over the Query: 265-312
View the alignment between query and template
View the model in PyMOL