Citrus Sinensis ID: 021320

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

MEQETEAYVSKAAALMACVLMTLSYVGILYAPTLILRLPPPASLKHYLIRRFICAAISSIISLIFSALILPIRSWETSNVLGVYGIRADHMWQAAVFPLFLTSLMYAGSMVLKSLLLLNSWTTDMNNSGGLSLGCIKIVLWSLRAQMFAVASNILAWRNFVVAPLTEELVFRACMIPLLLCGGFKINTIIFLCPVFFSLAHLNHLMEIYSAQNFSLLKASMIVGLQLGYTVVFGWYASFLFIRTGHLAAPLIAHIFCNYMGLPVLFARNRGLVSVAFVAGMVAFLWLLFPITRPDLYNDRTNNCRCLHGYCSWN

ccccccccccHHHHHHHHHHHHHHHHEEEECccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccc

*********SKAAALMACVLMTLSYVGILYAPTLILRLPPPASLKHYLIRRFICAAISSIISLIFSALILPIRSWETSNVLGVYGIRADHMWQAAVFPLFLTSLMYAGSMVLKSLLLLNSWTTDMNNSGGLSLGCIKIVLWSLRAQMFAVASNILAWRNFVVAPLTEELVFRACMIPLLLCGGFKINTIIFLCPVFFSLAHLNHLMEIYSAQNFSLLKASMIVGLQLGYTVVFGWYASFLFIRTGHLAAPLIAHIFCNYMGLPVLFARNRGLVSVAFVAGMVAFLWLLFPITRPDLYNDRTNNCRCLHGYCSW*

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
CAAX prenyl protease 2	Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. The substrate specificity is only partially overlaping with that of FACE1.	probable	Q8GW19

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted