Citrus Sinensis ID: 021321

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MKALLSSLQTLPVSTASTDVNKTKSLDITRRSSIGFGSSVILSSFLVNFCSPSSTLPSFRSAIALQQKDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEGTGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPYSNRF
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHcccccEEEEEEEEEEcccccccHHHccccccccccccccEEEEccccEEEcccccccccccccccccEEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEccccccccEEcccccccccccEEEEEcccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccEEEEEcEEEccccccccEEEEEEccHHHHHHHHHHHHHccEEccccc
cHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccHHHHccccccHcccccccHHHHHHHHcccEEEEEEEEEEcccccccccccccccccccccccccEEEEccccEEEEcccEHHccccccccccEEEEEEEccccccEEEEEEEEcccccccEEEEEEccccccccEEEEccccccEcccEEEEEcccccccccEEEEEEEEcccccccccccccccEEEEcccEccccccccEEEcccEEEEEEEEEEccccccccccccEHccHHHHHHHHHHHHHcccEEEccc
MKALLSSlqtlpvstastdvnktkslditrrssigfgSSVILSSFLvnfcspsstlpsfrSAIALQQKDELQLEEDRVVQLFqetspsvvsiqdlelsknpkstsselmlvdgeyakvegtgsgfvwdkfghIVTNYHVVAKLAtdtsglhrckvslfdakgngfyregkmvgcdpaydLAVLKVDVegfelkpvvlgtshdlrvgqscfaignpygfedtlttgvvsglgreipspngrairgaiqtdaainsgnsggplmnsfghvigvntatftrkgtglssgvnfaipidtvvrTVPYLivygtpysnrf
mkallsslqtlpvstastdvnktkslditrrssiGFGSSVILSSFLVNFCSPSSTLPSFRSAIALQQKDELQLEEDRVVQLFQetspsvvsiqdlelsknpkstsselMLVDGEYAKVEGTGSGFVWDKFGHIVTNYHVVAKLAtdtsglhrCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKgtglssgvnfaipidtvvrtVPYLIVygtpysnrf
MKALLSSLQTLPVSTASTDVNKTKSLDITRRSSIGFGSSVILSSFLVNFCSPSSTLPSFRSAIALQQKDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEGTGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPYSNRF
*******************************SSIGFGSSVILSSFLVNFCSPSSTL**FR*AIA**************V*L***************************MLVDGEYAKVEGTGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREI******AIRGAIQT*AAI*******PLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTP*****
******************************RSSIGFGSSVILSSFLVNFCSPS***********************RVVQLFQETSPSVVSIQDLELS**************************FVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPY*N**
********QTLPVSTASTDVNKTKSLDITRRSSIGFGSSVILSSFLVNFCSPSSTLPSFRSAIALQQKDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEGTGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPYSNRF
********QTLPVSTASTDVNKTKSLDITRRSSIGFGSSVILSSFLVNFCSPSSTLPSFRSAIALQQKDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKS*SSELMLVDGEYA**EGTGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPYS**F
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKALLSSLQTLPVSTASTDVNKTKSLDITRRSSIGFGSSVILSSFLVNFCSPSSTLPSFRSAIALQQKDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEGTGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPYSNRF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query314 2.2.26 [Sep-21-2011]
Q9SEL7323 Protease Do-like 5, chlor yes no 0.745 0.724 0.760 1e-101
Q9LU10 448 Protease Do-like 8, chlor no no 0.805 0.564 0.466 2e-53
O22609 439 Protease Do-like 1, chlor no no 0.719 0.514 0.467 3e-49
Q2SL36 469 Probable periplasmic seri yes no 0.538 0.360 0.438 4e-30
Q4KGQ4 476 Probable periplasmic seri yes no 0.636 0.420 0.360 1e-29
P73354 452 Putative serine protease N/A no 0.665 0.462 0.393 1e-29
P73940 416 Putative serine protease N/A no 0.761 0.574 0.371 2e-29
P72780 394 Putative serine protease N/A no 0.509 0.406 0.441 5e-29
A4XSC0 474 Probable periplasmic seri yes no 0.563 0.373 0.405 2e-28
F6AA62 479 Probable periplasmic seri yes no 0.563 0.369 0.405 2e-28
>sp|Q9SEL7|DEGP5_ARATH Protease Do-like 5, chloroplastic OS=Arabidopsis thaliana GN=DEGP5 PE=1 SV=3 Back     alignment and function desciption
 Score =  368 bits (944), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 202/238 (84%), Gaps = 4/238 (1%)

Query: 77  RVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEGTGSGFVWDKFGHIVTN 136
           R V LFQ+TSPSVV I+ +EL K    TSS  +L D E  K+EGTGSGFVWDK GHIVTN
Sbjct: 90  RNVNLFQKTSPSVVYIEAIELPK----TSSGDILTDEENGKIEGTGSGFVWDKLGHIVTN 145

Query: 137 YHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVV 196
           YHV+AKLATD  GL RCKVSL DAKG  F +EGK+VG DP  DLAVLK++ EG EL PVV
Sbjct: 146 YHVIAKLATDQFGLQRCKVSLVDAKGTRFSKEGKIVGLDPDNDLAVLKIETEGRELNPVV 205

Query: 197 LGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGN 256
           LGTS+DLRVGQSCFAIGNPYG+E+TLT GVVSGLGREIPSPNG++I  AIQTDA INSGN
Sbjct: 206 LGTSNDLRVGQSCFAIGNPYGYENTLTIGVVSGLGREIPSPNGKSISEAIQTDADINSGN 265

Query: 257 SGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPYSNRF 314
           SGGPL++S+GH IGVNTATFTRKG+G+SSGVNFAIPIDTVVRTVPYLIVYGT Y +RF
Sbjct: 266 SGGPLLDSYGHTIGVNTATFTRKGSGMSSGVNFAIPIDTVVRTVPYLIVYGTAYRDRF 323
Probable serine protease.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q9LU10|DEGP8_ARATH Protease Do-like 8, chloroplastic OS=Arabidopsis thaliana GN=DEGP8 PE=1 SV=1 Back     alignment and function description
>sp|O22609|DEGP1_ARATH Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana GN=DEGP1 PE=1 SV=2 Back     alignment and function description
>sp|Q2SL36|DEGPL_HAHCH Probable periplasmic serine endoprotease DegP-like OS=Hahella chejuensis (strain KCTC 2396) GN=mucD PE=3 SV=1 Back     alignment and function description
>sp|Q4KGQ4|DEGPL_PSEF5 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mucD PE=1 SV=1 Back     alignment and function description
>sp|P73354|HTRA_SYNY3 Putative serine protease HtrA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=htrA PE=1 SV=1 Back     alignment and function description
>sp|P73940|HHOB_SYNY3 Putative serine protease HhoB OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hhoB PE=1 SV=1 Back     alignment and function description
>sp|P72780|HHOA_SYNY3 Putative serine protease HhoA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=hhoA PE=1 SV=1 Back     alignment and function description
>sp|A4XSC0|DEGPL_PSEMY Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas mendocina (strain ymp) GN=Pmen_1471 PE=3 SV=1 Back     alignment and function description
>sp|F6AA62|DEGPL_PSEF1 Probable periplasmic serine endoprotease DegP-like OS=Pseudomonas fulva (strain 12-X) GN=Psefu_3239 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
255557249326 Protease degS precursor, putative [Ricin 0.961 0.926 0.729 1e-121
388503124315 unknown [Lotus japonicus] 0.929 0.926 0.713 1e-121
225443904313 PREDICTED: protease Do-like 5, chloropla 0.885 0.888 0.776 1e-119
356546506304 PREDICTED: protease Do-like 5, chloropla 0.955 0.986 0.711 1e-119
449439571304 PREDICTED: protease Do-like 5, chloropla 0.894 0.924 0.698 1e-113
357447247316 Protease Do-like protein [Medicago trunc 0.907 0.901 0.733 1e-111
224114273298 predicted protein [Populus trichocarpa] 0.923 0.973 0.707 1e-110
388500474316 unknown [Medicago truncatula] 0.907 0.901 0.729 1e-110
356557803306 PREDICTED: protease Do-like 5, chloropla 0.952 0.977 0.673 1e-108
297804332320 hypothetical protein ARALYDRAFT_493027 [ 0.882 0.865 0.688 1e-102
>gi|255557249|ref|XP_002519655.1| Protease degS precursor, putative [Ricinus communis] gi|223541072|gb|EEF42628.1| Protease degS precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 221/303 (72%), Positives = 250/303 (82%), Gaps = 1/303 (0%)

Query: 12  PVSTASTDVNKTKSLDITRRSSIGFGSSVILSSFLVNFCSPSSTLPSFRSAIALQQKDEL 71
           P S     +NK+      RR+ +GFGSS++++S L      S       SAIALQ+ D+L
Sbjct: 25  PCSNIEDSLNKSLINLARRRAVVGFGSSMVMASLLNVHNLNSLLPSLLHSAIALQE-DDL 83

Query: 72  QLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEGTGSGFVWDKFG 131
           Q EEDRVV LFQ TSPSVV I+DLEL+K PKS+S++  L + E AKVEGTGSGF+WD FG
Sbjct: 84  QKEEDRVVNLFQLTSPSVVFIKDLELAKIPKSSSNDATLTEDENAKVEGTGSGFIWDTFG 143

Query: 132 HIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFE 191
           HIVTNYHVVAKLATD SGL RCKV L D+ GN  YREGK++G DPAYDLAVLKVDVEG E
Sbjct: 144 HIVTNYHVVAKLATDQSGLQRCKVFLVDSAGNSLYREGKIIGFDPAYDLAVLKVDVEGHE 203

Query: 192 LKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAA 251
           LKP VLGTS DL VGQSCFAIGNPYG+E+TLTTGV+SGLGREIPSP GRAIRGAIQTDAA
Sbjct: 204 LKPAVLGTSRDLLVGQSCFAIGNPYGYENTLTTGVISGLGREIPSPTGRAIRGAIQTDAA 263

Query: 252 INSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGTPYS 311
           IN+GNSGGPL+NS+GHVIGVNTATFTRKGTG+SSGVNFAIPID+VVRTVPYLIVYGTPY 
Sbjct: 264 INAGNSGGPLINSYGHVIGVNTATFTRKGTGVSSGVNFAIPIDSVVRTVPYLIVYGTPYI 323

Query: 312 NRF 314
           +RF
Sbjct: 324 DRF 326

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|388503124|gb|AFK39628.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|225443904|ref|XP_002278272.1| PREDICTED: protease Do-like 5, chloroplastic [Vitis vinifera] gi|297740743|emb|CBI30925.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546506|ref|XP_003541667.1| PREDICTED: protease Do-like 5, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449439571|ref|XP_004137559.1| PREDICTED: protease Do-like 5, chloroplastic-like [Cucumis sativus] gi|449523866|ref|XP_004168944.1| PREDICTED: protease Do-like 5, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357447247|ref|XP_003593899.1| Protease Do-like protein [Medicago truncatula] gi|355482947|gb|AES64150.1| Protease Do-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224114273|ref|XP_002316715.1| predicted protein [Populus trichocarpa] gi|222859780|gb|EEE97327.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388500474|gb|AFK38303.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356557803|ref|XP_003547200.1| PREDICTED: protease Do-like 5, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|297804332|ref|XP_002870050.1| hypothetical protein ARALYDRAFT_493027 [Arabidopsis lyrata subsp. lyrata] gi|297315886|gb|EFH46309.1| hypothetical protein ARALYDRAFT_493027 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query314
TAIR|locus:2124509323 DEG5 "degradation of periplasm 0.971 0.944 0.656 1.2e-99
UNIPROTKB|Q607N4 374 MCA1725 "Putative serine prote 0.554 0.465 0.513 1.6e-55
TAIR|locus:2151916 448 DEG8 "degradation of periplasm 0.894 0.627 0.439 1.7e-50
TAIR|locus:2086420 439 DEG1 "degradation of periplasm 0.560 0.400 0.531 7.3e-43
UNIPROTKB|Q608M3 473 MCA1467 "Serine protease, MucD 0.566 0.376 0.413 1.3e-29
TIGR_CMR|APH_1148 490 APH_1148 "protease DO family p 0.544 0.348 0.454 1.3e-29
TIGR_CMR|GSU_0080 471 GSU_0080 "protease degQ" [Geob 0.668 0.445 0.391 1.6e-29
UNIPROTKB|P72780 394 hhoA "Putative serine protease 0.560 0.446 0.43 5.6e-29
UNIPROTKB|Q3AEC4376 htrA "Serine protease Do" [Car 0.550 0.460 0.429 3.1e-28
TIGR_CMR|CHY_0655376 CHY_0655 "putative serine prot 0.550 0.460 0.429 3.1e-28
TAIR|locus:2124509 DEG5 "degradation of periplasmic proteins 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 989 (353.2 bits), Expect = 1.2e-99, P = 1.2e-99
 Identities = 212/323 (65%), Positives = 248/323 (76%)

Query:     2 KALLSSLQTL-PVST-----ASTDVNKTKSLDITRRSSIGFGSSVILSSFLVNFCSPSST 55
             KA  S   TL P++      A +  N    +D  RR  I FGSS+ L+S L+   S    
Sbjct:     9 KAFSSIFNTLSPINQSKFVLACSGSNHVDVIDRRRRIMI-FGSSLALTSSLLG--SNQQR 65

Query:    56 LPSFRSAIALQQ----KDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLV 111
             LP   SAIAL+Q    ++EL+ EE+R V LFQ+TSPSVV I+ +EL   PK++S ++ L 
Sbjct:    66 LP-MESAIALEQFKEKEEELEEEEERNVNLFQKTSPSVVYIEAIEL---PKTSSGDI-LT 120

Query:   112 DGEYAKVEGTGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKM 171
             D E  K+EGTGSGFVWDK GHIVTNYHV+AKLATD  GL RCKVSL DAKG  F +EGK+
Sbjct:   121 DEENGKIEGTGSGFVWDKLGHIVTNYHVIAKLATDQFGLQRCKVSLVDAKGTRFSKEGKI 180

Query:   172 VGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLG 231
             VG DP  DLAVLK++ EG EL PVVLGTS+DLRVGQSCFAIGNPYG+E+TLT GVVSGLG
Sbjct:   181 VGLDPDNDLAVLKIETEGRELNPVVLGTSNDLRVGQSCFAIGNPYGYENTLTIGVVSGLG 240

Query:   232 REIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAI 291
             REIPSPNG++I  AIQTDA INSGNSGGPL++S+GH IGVNTATFTRKG+G+SSGVNFAI
Sbjct:   241 REIPSPNGKSISEAIQTDADINSGNSGGPLLDSYGHTIGVNTATFTRKGSGMSSGVNFAI 300

Query:   292 PIDTVVRTVPYLIVYGTPYSNRF 314
             PIDTVVRTVPYLIVYGT Y +RF
Sbjct:   301 PIDTVVRTVPYLIVYGTAYRDRF 323
GO:0003824 "catalytic activity" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008236 "serine-type peptidase activity" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009543 "chloroplast thylakoid lumen" evidence=IDA
GO:0031977 "thylakoid lumen" evidence=IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0010206 "photosystem II repair" evidence=IMP
GO:0016556 "mRNA modification" evidence=RCA
UNIPROTKB|Q607N4 MCA1725 "Putative serine protease" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:2151916 DEG8 "degradation of periplasmic proteins 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086420 DEG1 "degradation of periplasmic proteins 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q608M3 MCA1467 "Serine protease, MucD" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TIGR_CMR|APH_1148 APH_1148 "protease DO family protein" [Anaplasma phagocytophilum HZ (taxid:212042)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0080 GSU_0080 "protease degQ" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P72780 hhoA "Putative serine protease HhoA" [Synechocystis sp. PCC 6803 substr. Kazusa (taxid:1111708)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AEC4 htrA "Serine protease Do" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0655 CHY_0655 "putative serine protease HtrA" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SEL7DEGP5_ARATH3, ., 4, ., 2, 1, ., -0.76050.74520.7244yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
TIGR02037 428 TIGR02037, degP_htrA_DO, periplasmic serine protea 7e-53
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 9e-47
TIGR02038351 TIGR02038, protease_degS, periplasmic serine pepet 6e-39
PRK10898353 PRK10898, PRK10898, serine endoprotease; Provision 4e-28
PRK10942 473 PRK10942, PRK10942, serine endoprotease; Provision 7e-28
PRK10139 455 PRK10139, PRK10139, serine endoprotease; Provision 2e-25
pfam13365138 pfam13365, Trypsin_2, Trypsin-like peptidase domai 2e-20
pfam00089218 pfam00089, Trypsin, Trypsin 3e-12
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information 
 Score =  178 bits (454), Expect = 7e-53
 Identities = 90/246 (36%), Positives = 120/246 (48%), Gaps = 35/246 (14%)

Query: 79  VQLFQETSPSVVSIQDLELSKNPKSTSSELMLVD----------------GEYAKVEGTG 122
             L ++ +P+VV+I    +    K  +    L                      KV G G
Sbjct: 4   APLVEKVAPAVVNI---SVEGTVKRRNRPPALPPFFRQFFGDDMPDFPRQQREQKVRGLG 60

Query: 123 SGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAV 182
           SG +    G+++TN HVV   A +        V+L D    G   + K+VG DP  D+AV
Sbjct: 61  SGVIISADGYVLTNNHVVDG-ADEI------TVTLSD----GREFKAKLVGKDPRTDIAV 109

Query: 183 LKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAI 242
           LK+D +   L  + LG S  LRVG    AIGNP+G   T+T+G+VS LGR          
Sbjct: 110 LKIDAKK-NLPVIKLGDSDKLRVGDWVLAIGNPFGLGQTVTSGIVSALGRSGLGIGD--Y 166

Query: 243 RGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPY 302
              IQTDAAIN GNSGGPL+N  G VIG+NTA  +   +G + G+ FAIP +     V  
Sbjct: 167 ENFIQTDAAINPGNSGGPLVNLRGEVIGINTAILSP--SGGNVGIGFAIPSNMAKNVVDQ 224

Query: 303 LIVYGT 308
           LI  G 
Sbjct: 225 LIEGGK 230

This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 428
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233696 TIGR02038, protease_degS, periplasmic serine pepetdase DegS Back     alignment and domain information
>gnl|CDD|182820 PRK10898, PRK10898, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|182262 PRK10139, PRK10139, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|222077 pfam13365, Trypsin_2, Trypsin-like peptidase domain Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 314
PRK10139 455 serine endoprotease; Provisional 100.0
PRK10898353 serine endoprotease; Provisional 100.0
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 100.0
PRK10942 473 serine endoprotease; Provisional 100.0
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 100.0
COG0265347 DegQ Trypsin-like serine proteases, typically peri 99.95
KOG1320 473 consensus Serine protease [Posttranslational modif 99.8
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 99.7
KOG1421 955 consensus Predicted signaling-associated protein ( 99.62
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 99.61
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 99.53
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 99.4
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 99.15
KOG3627256 consensus Trypsin [Amino acid transport and metabo 98.8
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 98.79
COG5640 413 Secreted trypsin-like serine protease [Posttransla 98.58
KOG1320 473 consensus Serine protease [Posttranslational modif 98.56
KOG1421 955 consensus Predicted signaling-associated protein ( 98.42
PF05579297 Peptidase_S32: Equine arteritis virus serine endop 98.12
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 97.74
PF10459 698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 97.63
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 97.53
PF10459698 Peptidase_S46: Peptidase S46; InterPro: IPR019500 97.37
PF05580218 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR 96.73
PF08192695 Peptidase_S64: Peptidase family S64; InterPro: IPR 96.63
PF00949132 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine 96.08
PF02122203 Peptidase_S39: Peptidase S39; InterPro: IPR000382 95.59
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 95.23
PF00944158 Peptidase_S3: Alphavirus core protein ; InterPro: 94.96
PF03510105 Peptidase_C24: 2C endopeptidase (C24) cysteine pro 94.04
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 94.04
PF05416535 Peptidase_C37: Southampton virus-type processing p 92.85
PF00947127 Pico_P2A: Picornavirus core protein 2A; InterPro: 90.94
PF02907148 Peptidase_S29: Hepatitis C virus NS3 protease; Int 90.89
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 87.01
PF01732374 DUF31: Putative peptidase (DUF31); InterPro: IPR02 81.46
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2e-38  Score=302.74  Aligned_cols=223  Identities=32%  Similarity=0.512  Sum_probs=180.7

Q ss_pred             hHHHHHHHHhCCceEEEEeeeeecCCCCCccchhhcc------ccCCcccceEEEEEEcC-CCEEEeccccccCCCcCCC
Q 021321           76 DRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVD------GEYAKVEGTGSGFVWDK-FGHIVTNYHVVAKLATDTS  148 (314)
Q Consensus        76 ~~~~~~~~~~~~svV~I~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~GsGfiI~~-~g~VLT~aHvv~~~~~~~~  148 (314)
                      .++.++++++.||||.|.+......+......|...+      .......+.||||+|++ +||||||+|||+       
T Consensus        40 ~~~~~~~~~~~pavV~i~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSG~ii~~~~g~IlTn~HVv~-------  112 (455)
T PRK10139         40 PSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIIDAAKGYVLTNNHVIN-------  112 (455)
T ss_pred             ccHHHHHHHhCCcEEEEEEEEeecccccCchhHHHhccccCCccccccccceEEEEEEECCCCEEEeChHHhC-------
Confidence            3699999999999999998765432211111111111      11123457999999985 699999999999       


Q ss_pred             CcceEEEEEecCCCCeEEEEEEEEEeCCCCcEEEEEEeeCCCccceeecCCCCCCCCCCEEEEEEcCCCCCCCeEeeEEe
Q 021321          149 GLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVS  228 (314)
Q Consensus       149 ~~~~~~v~~~~~~g~~~~~~a~v~~~d~~~DlAlL~v~~~~~~~~~~~l~~~~~~~~G~~v~~iG~p~~~~~~~~~G~vs  228 (314)
                      +++.+.|++.+++    .++|++++.|+.+||||||++.+ ..+++++|+++..+++|++|+++|||++...+++.|+|+
T Consensus       113 ~a~~i~V~~~dg~----~~~a~vvg~D~~~DlAvlkv~~~-~~l~~~~lg~s~~~~~G~~V~aiG~P~g~~~tvt~GivS  187 (455)
T PRK10139        113 QAQKISIQLNDGR----EFDAKLIGSDDQSDIALLQIQNP-SKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIIS  187 (455)
T ss_pred             CCCEEEEEECCCC----EEEEEEEEEcCCCCEEEEEecCC-CCCceeEecCccccCCCCEEEEEecCCCCCCceEEEEEc
Confidence            5678899987644    78999999999999999999843 368899999999999999999999999999999999999


Q ss_pred             cccccccCCCCccccceEEEeeccCCCCcccceecCCCeEEEEEcccccCCCCCCccceEEEEehHHHHHHHHHHHHcCc
Q 021321          229 GLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGT  308 (314)
Q Consensus       229 ~~~~~~~~~~~~~~~~~i~~~~~~~~G~SGGPl~n~~G~vvGI~s~~~~~~~~~~~~~~~~aipi~~i~~~l~~l~~~~~  308 (314)
                      ...+......  .+..++++|+.+++|+|||||||.+|+||||+++.....  +...|++||||++.+++++++|+++|+
T Consensus       188 ~~~r~~~~~~--~~~~~iqtda~in~GnSGGpl~n~~G~vIGi~~~~~~~~--~~~~gigfaIP~~~~~~v~~~l~~~g~  263 (455)
T PRK10139        188 ALGRSGLNLE--GLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPG--GGSVGIGFAIPSNMARTLAQQLIDFGE  263 (455)
T ss_pred             cccccccCCC--CcceEEEECCccCCCCCcceEECCCCeEEEEEEEEEcCC--CCccceEEEEEhHHHHHHHHHHhhcCc
Confidence            8876422211  235689999999999999999999999999999876542  235789999999999999999999999


Q ss_pred             cCCCCC
Q 021321          309 PYSNRF  314 (314)
Q Consensus       309 ~~~~~~  314 (314)
                      +.|+|+
T Consensus       264 v~r~~L  269 (455)
T PRK10139        264 IKRGLL  269 (455)
T ss_pred             ccccce
Confidence            999986

>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3627 consensus Trypsin [Amino acid transport and metabolism] Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1320 consensus Serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1421 consensus Predicted signaling-associated protein (contains a PDZ domain) [General function prediction only] Back     alignment and domain information
>PF05579 Peptidase_S32: Equine arteritis virus serine endopeptidase S32; InterPro: IPR008760 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF10459 Peptidase_S46: Peptidase S46; InterPro: IPR019500 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05580 Peptidase_S55: SpoIVB peptidase S55; InterPro: IPR008763 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08192 Peptidase_S64: Peptidase family S64; InterPro: IPR012985 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00949 Peptidase_S7: Peptidase S7, Flavivirus NS3 serine protease ; InterPro: IPR001850 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02122 Peptidase_S39: Peptidase S39; InterPro: IPR000382 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PF00944 Peptidase_S3: Alphavirus core protein ; InterPro: IPR000930 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03510 Peptidase_C24: 2C endopeptidase (C24) cysteine protease family; InterPro: IPR000317 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05416 Peptidase_C37: Southampton virus-type processing peptidase; InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00947 Pico_P2A: Picornavirus core protein 2A; InterPro: IPR000081 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02907 Peptidase_S29: Hepatitis C virus NS3 protease; InterPro: IPR004109 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01732 DUF31: Putative peptidase (DUF31); InterPro: IPR022382 This domain has no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
3qo6_A 348 Crystal Structure Analysis Of The Plant Protease De 5e-50
1l1j_A239 Crystal Structure Of The Protease Domain Of An Atp- 1e-30
1y8t_A324 Crystal Structure Of Rv0983 From Mycobacterium Tube 9e-29
3nzi_A 334 Substrate Induced Remodeling Of The Active Site Reg 8e-26
3num_A 332 Substrate Induced Remodeling Of The Active Site Reg 2e-25
2zle_A 448 Cryo-Em Structure Of Degp12OMP Length = 448 2e-25
3mh5_A 456 Htra Proteases Are Activated By A Conserved Mechani 2e-25
3nwu_A227 Substrate Induced Remodeling Of The Active Site Reg 2e-25
3otp_A 459 Crystal Structure Of The Degp Dodecamer With A Mode 4e-25
3mh4_A 456 Htra Proteases Are Activated By A Conserved Mechani 4e-25
4a8d_A 448 Degp Dodecamer With Bound Omp Length = 448 4e-25
3tjn_A228 Htra1 Catalytic Domain, Apo Form Length = 228 5e-25
3tjo_A231 Htra1 Catalytic Domain, Mutationally Inactivated Le 1e-24
3lgi_A237 Structure Of The Protease Domain Of Degs (Degs-Delt 1e-24
2qf3_A243 Structure Of The Delta Pdz Truncation Of The Degs P 1e-24
2r3u_A211 Crystal Structure Of The Pdz Deletion Mutant Of Deg 2e-24
3lgv_A241 H198p Mutant Of The Degs-Deltapdz Protease Length = 2e-24
1soz_A314 Crystal Structure Of Degs Protease In Complex With 2e-24
3pv2_A 451 Structure Of Legionella Fallonii Degq (Wt) Length = 4e-24
3pv4_A354 Structure Of Legionella Fallonii Degq (Delta-Pdz2 V 4e-24
2rce_A243 Dfp Modified Degs Delta Pdz Length = 243 4e-24
3lh3_A241 Dfp Modified Degs Delta Pdz Length = 241 5e-24
3lgw_A241 H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease 6e-24
3gcn_A340 Crystal Structure Of Degs H198pD320A MUTANT MODIFIE 6e-24
3b8j_A243 Q191a Mutant Of Degs-Deltapdz Length = 243 8e-24
2qf0_A243 Structure Of The Delta Pdz Truncation Of The Degs P 8e-24
3pv3_A 451 Structure Of Legionella Fallonii Degq (S193a Varian 9e-24
3lh1_A241 Q191a Mutant Of The Degs-Deltapdz Length = 241 9e-24
2qgr_A243 Structure Of The R178a Mutant Of Delta Pdz Degs Pro 1e-23
3lgy_A241 R178a Mutant Of The Degs-Deltapdz Protease Length = 1e-23
3cs0_A 448 Crystal Structure Of Degp24 Length = 448 1e-23
1sot_A 320 Crystal Structure Of The Degs Stress Sensor Length 1e-23
3lgu_A241 Y162a Mutant Of The Degs-Deltapdz Protease Length = 1e-23
3lgt_A241 Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease 1e-23
1ky9_A 448 Crystal Structure Of Degp (Htra) Length = 448 2e-23
3mh7_A 456 Htra Proteases Are Activated By A Conserved Mechani 2e-23
1te0_A318 Structural Analysis Of Degs, A Stress Sensor Of The 3e-23
3pv5_A 451 Structure Of Legionella Fallonii Degq (N189gP190G V 3e-23
3stj_A 345 Crystal Structure Of The Protease + Pdz1 Domain Of 4e-23
3sti_A245 Crystal Structure Of The Protease Domain Of Degq Fr 5e-23
4a8a_A 436 Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 1 1e-22
1lcy_A 325 Crystal Structure Of The Mitochondrial Serine Prote 1e-18
4fln_A 539 Crystal Structure Of Plant Protease Deg2 Length = 5 7e-08
>pdb|3QO6|A Chain A, Crystal Structure Analysis Of The Plant Protease Deg1 Length = 348 Back     alignment and structure 
Iteration: 1

 Score =  194 bits (493), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 159/248 (64%), Gaps = 22/248 (8%)
Query: 61  SAIALQQKDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEG 120
           +A  +    +LQ +E   V+LFQE +PSVV I +L + ++  + + +++ V       +G
Sbjct: 2   AAFVVSTPKKLQTDELATVRLFQENTPSVVYITNLAVRQD--AFTLDVLEVP------QG 53
Query: 121 TGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDL 180
           +GSGFVWDK GHIVTNYHV+        G    +V+L D        + K+VG D   D+
Sbjct: 54  SGSGFVWDKQGHIVTNYHVI-------RGASDLRVTLADQT----TFDAKVVGFDQDKDV 102
Query: 181 AVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPS-PNG 239
           AVL++D    +L+P+ +G S DL VGQ  FAIGNP+G + TLTTGV+SGL REI S   G
Sbjct: 103 AVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATG 162
Query: 240 RAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRT 299
           R I+  IQTDAAIN GNSGGPL++S G +IG+NTA ++   +G SSGV F+IP+DTV   
Sbjct: 163 RPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSP--SGASSGVGFSIPVDTVGGI 220
Query: 300 VPYLIVYG 307
           V  L+ +G
Sbjct: 221 VDQLVRFG 228
>pdb|1L1J|A Chain A, Crystal Structure Of The Protease Domain Of An Atp- Independent Heat Shock Protease Htra Length = 239 Back     alignment and structure
>pdb|1Y8T|A Chain A, Crystal Structure Of Rv0983 From Mycobacterium Tuberculosis- Proteolytically Active Form Length = 324 Back     alignment and structure
>pdb|3NZI|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 334 Back     alignment and structure
>pdb|3NUM|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 332 Back     alignment and structure
>pdb|2ZLE|A Chain A, Cryo-Em Structure Of Degp12OMP Length = 448 Back     alignment and structure
>pdb|3MH5|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|3NWU|A Chain A, Substrate Induced Remodeling Of The Active Site Regulates Htra1 Activity Length = 227 Back     alignment and structure
>pdb|3OTP|A Chain A, Crystal Structure Of The Degp Dodecamer With A Model Substrate Length = 459 Back     alignment and structure
>pdb|3MH4|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|4A8D|A Chain A, Degp Dodecamer With Bound Omp Length = 448 Back     alignment and structure
>pdb|3TJN|A Chain A, Htra1 Catalytic Domain, Apo Form Length = 228 Back     alignment and structure
>pdb|3TJO|A Chain A, Htra1 Catalytic Domain, Mutationally Inactivated Length = 231 Back     alignment and structure
>pdb|3LGI|A Chain A, Structure Of The Protease Domain Of Degs (Degs-Deltapdz) At 1.65 A Length = 237 Back     alignment and structure
>pdb|2QF3|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|2R3U|A Chain A, Crystal Structure Of The Pdz Deletion Mutant Of Degs Length = 211 Back     alignment and structure
>pdb|3LGV|A Chain A, H198p Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|1SOZ|A Chain A, Crystal Structure Of Degs Protease In Complex With An Activating Peptide Length = 314 Back     alignment and structure
>pdb|3PV2|A Chain A, Structure Of Legionella Fallonii Degq (Wt) Length = 451 Back     alignment and structure
>pdb|3PV4|A Chain A, Structure Of Legionella Fallonii Degq (Delta-Pdz2 Variant) Length = 354 Back     alignment and structure
>pdb|2RCE|A Chain A, Dfp Modified Degs Delta Pdz Length = 243 Back     alignment and structure
>pdb|3LH3|A Chain A, Dfp Modified Degs Delta Pdz Length = 241 Back     alignment and structure
>pdb|3LGW|A Chain A, H198pT167V DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3GCN|A Chain A, Crystal Structure Of Degs H198pD320A MUTANT MODIFIED BY DFP IN Complex With Omp Peptide (Yqf) Length = 340 Back     alignment and structure
>pdb|3B8J|A Chain A, Q191a Mutant Of Degs-Deltapdz Length = 243 Back     alignment and structure
>pdb|2QF0|A Chain A, Structure Of The Delta Pdz Truncation Of The Degs Protease Length = 243 Back     alignment and structure
>pdb|3PV3|A Chain A, Structure Of Legionella Fallonii Degq (S193a Variant) Length = 451 Back     alignment and structure
>pdb|3LH1|A Chain A, Q191a Mutant Of The Degs-Deltapdz Length = 241 Back     alignment and structure
>pdb|2QGR|A Chain A, Structure Of The R178a Mutant Of Delta Pdz Degs Protease Length = 243 Back     alignment and structure
>pdb|3LGY|A Chain A, R178a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3CS0|A Chain A, Crystal Structure Of Degp24 Length = 448 Back     alignment and structure
>pdb|1SOT|A Chain A, Crystal Structure Of The Degs Stress Sensor Length = 320 Back     alignment and structure
>pdb|3LGU|A Chain A, Y162a Mutant Of The Degs-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|3LGT|A Chain A, Y162aH198P DOUBLE MUTANT OF DEGS-Deltapdz Protease Length = 241 Back     alignment and structure
>pdb|1KY9|A Chain A, Crystal Structure Of Degp (Htra) Length = 448 Back     alignment and structure
>pdb|3MH7|A Chain A, Htra Proteases Are Activated By A Conserved Mechanism That Can Be Triggered By Distinct Molecular Cues Length = 456 Back     alignment and structure
>pdb|1TE0|A Chain A, Structural Analysis Of Degs, A Stress Sensor Of The Bacterial Periplasm Length = 318 Back     alignment and structure
>pdb|3PV5|A Chain A, Structure Of Legionella Fallonii Degq (N189gP190G VARIANT) Length = 451 Back     alignment and structure
>pdb|3STJ|A Chain A, Crystal Structure Of The Protease + Pdz1 Domain Of Degq From Escherichia Coli Length = 345 Back     alignment and structure
>pdb|3STI|A Chain A, Crystal Structure Of The Protease Domain Of Degq From Escherichia Coli Length = 245 Back     alignment and structure
>pdb|4A8A|A Chain A, Asymmetric Cryo-Em Reconstruction Of E. Coli Degq 12-Mer In Complex With Lysozyme Length = 436 Back     alignment and structure
>pdb|1LCY|A Chain A, Crystal Structure Of The Mitochondrial Serine Protease Htra2 Length = 325 Back     alignment and structure
>pdb|4FLN|A Chain A, Crystal Structure Of Plant Protease Deg2 Length = 539 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query314
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 2e-86
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 4e-65
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 3e-62
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 2e-58
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 3e-58
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 7e-58
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 3e-57
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 1e-56
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 3e-53
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 4e-53
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 1e-52
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 2e-52
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 7e-52
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 2e-51
3k6y_A237 Serine protease, possible membrane-associated seri 3e-49
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 2e-47
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 3e-46
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 6e-46
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 1e-35
2w5e_A163 Putative serine protease; coiled coil, transmembra 9e-32
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 6e-28
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 5e-21
2o8l_A274 V8 protease, taphylococcal serine; serine protease 3e-13
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 4e-13
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 5e-11
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 6e-11
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 3e-10
1hpg_A187 Glutamic acid specific protease; serine protease, 3e-10
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 9e-10
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 1e-08
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 4e-07
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 2e-04
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Length = 348 Back     alignment and structure
 Score =  262 bits (671), Expect = 2e-86
 Identities = 115/248 (46%), Positives = 155/248 (62%), Gaps = 22/248 (8%)

Query: 61  SAIALQQKDELQLEEDRVVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEG 120
           +A  +    +LQ +E   V+LFQE +PSVV I +L + ++  +               +G
Sbjct: 2   AAFVVSTPKKLQTDELATVRLFQENTPSVVYITNLAVRQDAFT--------LDVLEVPQG 53

Query: 121 TGSGFVWDKFGHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDL 180
           +GSGFVWDK GHIVTNYHV+        G    +V+L D     F  + K+VG D   D+
Sbjct: 54  SGSGFVWDKQGHIVTNYHVIR-------GASDLRVTLAD--QTTF--DAKVVGFDQDKDV 102

Query: 181 AVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPS-PNG 239
           AVL++D    +L+P+ +G S DL VGQ  FAIGNP+G + TLTTGV+SGL REI S   G
Sbjct: 103 AVLRIDAPKNKLRPIPVGVSADLLVGQKVFAIGNPFGLDHTLTTGVISGLRREISSAATG 162

Query: 240 RAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRT 299
           R I+  IQTDAAIN GNSGGPL++S G +IG+NTA ++   +G SSGV F+IP+DTV   
Sbjct: 163 RPIQDVIQTDAAINPGNSGGPLLDSSGTLIGINTAIYSP--SGASSGVGFSIPVDTVGGI 220

Query: 300 VPYLIVYG 307
           V  L+ +G
Sbjct: 221 VDQLVRFG 228
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Length = 239 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Length = 237 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Length = 231 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Length = 245 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Length = 210 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Length = 237 Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Length = 242 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Length = 200 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Length = 204 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Length = 163 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Length = 185 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Length = 213 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Length = 198 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Length = 191 Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Length = 209 Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Length = 187 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Length = 181 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Length = 189 Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Length = 186 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 100.0
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 100.0
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 100.0
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 100.0
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 100.0
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 100.0
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 100.0
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 100.0
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 100.0
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 100.0
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 100.0
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 100.0
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 100.0
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 100.0
3k6y_A237 Serine protease, possible membrane-associated seri 100.0
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.92
2w5e_A163 Putative serine protease; coiled coil, transmembra 99.91
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.9
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.88
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.88
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.87
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.86
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 99.86
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.84
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.83
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.81
1hpg_A187 Glutamic acid specific protease; serine protease, 99.81
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.78
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.76
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.75
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 99.71
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 99.69
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 99.68
1a7s_A225 Heparin binding protein; serine protease homolog, 99.67
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 99.67
2z7f_E218 Leukocyte elastase; serine protease, serine protea 99.66
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 99.66
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 99.66
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 99.66
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 99.66
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 99.66
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 99.65
2xw9_A228 Complement factor D; immune system, hydrolase, ser 99.65
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 99.65
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 99.65
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 99.65
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 99.64
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 99.64
1ao5_A237 Glandular kallikrein-13; serine protease, protein 99.64
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 99.64
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 99.64
2aiq_A231 Protein C activator; snake venom serine proteinase 99.64
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 99.64
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 99.64
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 99.63
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 99.63
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 99.63
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 99.63
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 99.63
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 99.63
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 99.63
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 99.63
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 99.62
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 99.62
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 99.62
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 99.62
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 99.62
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 99.62
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 99.61
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 99.61
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 99.6
1azz_A226 Collagenase; complex (serine protease/inhibitor), 99.6
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 99.6
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 99.6
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 99.6
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 99.6
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 99.6
2asu_B234 Hepatocyte growth factor-like protein; serine prot 99.59
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 99.59
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 99.59
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 99.59
1euf_A227 Duodenase; serine protease, dual specificity, hydr 99.58
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 99.58
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 99.58
1aut_C250 Activated protein C; serine proteinase, plasma cal 99.58
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 99.58
2jde_A276 Urokinase-type plasminogen activator; plasminogen 99.58
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 99.57
2r0l_A248 Hepatocyte growth factor activator; serine proteas 99.57
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 99.57
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 99.57
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 99.57
3fan_A213 Non-structural protein; chymotrypsin-like, N-termi 99.57
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 99.57
3bg8_A238 Coagulation factor XIA light chain; protease inhib 99.56
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 99.56
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 99.55
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 99.55
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 99.53
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 99.53
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 99.52
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 99.52
2qy0_B242 Complement C1R subcomponent; serine protease, beta 99.51
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 99.51
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 99.5
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 99.5
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 99.5
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 99.5
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 99.49
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.48
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 99.48
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.46
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 99.46
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 99.45
2xxl_A408 GRAM-positive specific serine protease, isoform B; 99.44
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 99.42
1md8_A329 C1R complement serine protease; innate immunity, a 99.42
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 99.41
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 99.4
1elv_A333 Complement C1S component; trypsin-like serin prote 99.39
1gpz_A399 Complement C1R component; hydrolase, activation, i 99.39
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 99.38
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 99.37
2xrc_A565 Human complement factor I; immune system, hydrolas 99.34
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 99.33
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 99.31
3hrz_D741 Complement factor B; serine protease, glycosilated 99.26
2odp_A509 Complement C2; C3/C5 convertase, complement serin 99.26
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 99.0
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 98.97
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 98.94
1lvm_A229 Catalytic domain of the nuclear inclusion protein 98.72
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 98.02
3qzr_A187 3C protein; chymotrypsin-fold, beta-ribbon, hydrol 97.91
3zve_A190 3C protease; hydrolase, michael inhibitor; HET: G8 97.86
2hal_A212 Hepatitis A protease 3C; 3C protease, inhibitor de 97.83
3q3y_A191 HEVB EV93 3C protease; cysteine trypsin-like prote 97.82
4dcd_A190 Protease 3C, genome polyprotein; antiviral inhibit 97.79
2b0f_A182 Picornain 3C (protease 3C) (P3C); beta barrel, hyd 97.76
1cqq_A180 Type 2 rhinovirus 3C protease; viral protein, hydr 97.59
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 97.33
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 97.0
2ijd_1 644 Picornain 3C, RNA-directed RNA polymerase; RNA-dep 96.81
4ash_A185 NS6 protease; hydrolase, trypsin-like, calicivirus 96.17
2fyq_A194 Chymotrypsin-like cysteine proteinase; protease, n 95.69
2fom_B185 Polyprotein; flavivirus, NS3 protease, NS2B cofact 94.37
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 94.18
3u1j_B191 Serine protease NS3; serine protease, ER MEM hydro 94.09
2fp7_B172 Serine protease NS3; flavivirus, NS3 protease, NS2 93.89
2ggv_B185 NS3, non-structural protein 3; beta barrel, serine 93.69
4agk_A158 Capsid protein, coat protein, C; hydrolase, viral 93.55
3e90_B198 NS3 protease; trypsin-like serine protease, protea 93.54
2yew_A253 Capsid protein, coat protein; alphavirus, molecula 93.33
1ep5_B157 Capsid protein C, coat protein C; beta barrel, hyd 93.3
1svp_A161 Sindbis virus capsid protein; chymotrypsin-like se 93.27
1vcp_A149 Semliki forest virus capsid protein; virus coat pr 93.11
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 92.98
3lkw_A236 Fusion protein of nonstructural protein 2B and non 92.7
3su6_A203 NS3 protease, NS4A protein; drug resistance, drug 84.91
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=3.2e-39  Score=284.60  Aligned_cols=222  Identities=33%  Similarity=0.526  Sum_probs=159.5

Q ss_pred             hHHHHHHHHhCCceEEEEeeeeecCCC---CCccchhhc---cccCCcccceEEEEEEcCC-CEEEeccccccCCCcCCC
Q 021321           76 DRVVQLFQETSPSVVSIQDLELSKNPK---STSSELMLV---DGEYAKVEGTGSGFVWDKF-GHIVTNYHVVAKLATDTS  148 (314)
Q Consensus        76 ~~~~~~~~~~~~svV~I~~~~~~~~~~---~~~~~~~~~---~~~~~~~~~~GsGfiI~~~-g~VLT~aHvv~~~~~~~~  148 (314)
                      .++.++++++.||||+|.+......+.   ..+..++..   +.......+.||||+|+++ ||||||+||++       
T Consensus        13 ~~~~~~~~~~~paVV~I~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~GSGfiI~~~~G~IlTnaHvv~-------   85 (245)
T 3sti_A           13 PSLAPMLEKVLPAVVSVRVEGTASQGQKIPEEFKKFFGDDLPDQPAQPFEGLGSGVIINASKGYVLTNNHVIN-------   85 (245)
T ss_dssp             CBSHHHHHHHGGGEEEC----------------------------------CCEEEEEETTTTEEEECGGGC--------
T ss_pred             CCHHHHHHHhCCceEEEEEEEeeccccccchhhhhhccccccccccccccceEEEEEEeCCCCEEEEcHHHhC-------
Confidence            357889999999999999876443110   001111110   0112234679999999987 99999999999       


Q ss_pred             CcceEEEEEecCCCCeEEEEEEEEEeCCCCcEEEEEEeeCCCccceeecCCCCCCCCCCEEEEEEcCCCCCCCeEeeEEe
Q 021321          149 GLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVGQSCFAIGNPYGFEDTLTTGVVS  228 (314)
Q Consensus       149 ~~~~~~v~~~~~~g~~~~~~a~v~~~d~~~DlAlL~v~~~~~~~~~~~l~~~~~~~~G~~v~~iG~p~~~~~~~~~G~vs  228 (314)
                      +.+.+.|.+.+  |+  .+.++++..|+.+||||||++.+ ..+++++|+++..++.|++|+++|||++...+++.|+|+
T Consensus        86 ~a~~i~V~~~d--g~--~~~a~vv~~d~~~DlAlLkv~~~-~~~~~~~l~~s~~~~~G~~v~aiG~P~g~~~~vt~G~vs  160 (245)
T 3sti_A           86 QAQKISIQLND--GR--EFDAKLIGSDDQSDIALLQIQNP-SKLTQIAIADSDKLRVGDFAVAVGNPFGLGQTATSGIVS  160 (245)
T ss_dssp             ---CEEEECTT--SC--EEEEEEEEEETTTTEEEEEESSC-CSCCCCCBCCGGGCCTTBEEEEEECGGGSCCEEEEEEEE
T ss_pred             CCCEEEEEECC--CC--EEEEEEEEecCCCCEEEEEeccC-CCCceeeecCcCCCCCCCEEEEEECCCCCCCcEEeeEEe
Confidence            45677787755  44  67899999999999999999753 368899998878899999999999999998999999999


Q ss_pred             cccccccCCCCccccceEEEeeccCCCCcccceecCCCeEEEEEcccccCCCCCCccceEEEEehHHHHHHHHHHHHcCc
Q 021321          229 GLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSGVNFAIPIDTVVRTVPYLIVYGT  308 (314)
Q Consensus       229 ~~~~~~~~~~~~~~~~~i~~~~~~~~G~SGGPl~n~~G~vvGI~s~~~~~~~~~~~~~~~~aipi~~i~~~l~~l~~~~~  308 (314)
                      ...+...  ....+..++++|+.+++|+|||||||.+|+||||+++.....  +...+++||||++.+++++++|+++|+
T Consensus       161 ~~~~~~~--~~~~~~~~i~tda~i~~G~SGGPLvn~~G~vVGI~s~~~~~~--~~~~g~~faIP~~~~~~~~~~l~~~g~  236 (245)
T 3sti_A          161 ALGRSGL--NLEGLENFIQTDASINRGNSGGALLNLNGELIGINTAILAPG--GGSVGIGFAIPSNMARTLAQQLIDFGE  236 (245)
T ss_dssp             ECSSCSS--CCTTCSSCEEESSCCCTTTTTSEEECTTSCEEEEEECCC--------CCCEEEEEHHHHHHHHHHHHHHHH
T ss_pred             eeccccc--CCCCccCEEEEcCCcCCCcchhHeecCCCeEEEEEEeEECCC--CCcceEEEEEeHHHHHHHHHHHHHcCC
Confidence            8876511  112235679999999999999999999999999999987643  235689999999999999999999999


Q ss_pred             cCCCC
Q 021321          309 PYSNR  313 (314)
Q Consensus       309 ~~~~~  313 (314)
                      ..++|
T Consensus       237 ~~~~~  241 (245)
T 3sti_A          237 ILEHH  241 (245)
T ss_dssp             HC---
T ss_pred             CCCcc
Confidence            98887
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>3fan_A Non-structural protein; chymotrypsin-like, N-terminal beta-barrels, C-terminal alpha-beta extra domain; 1.90A {Porcine respiratory and reproductivesyndrome virus} PDB: 3fao_A Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Back     alignment and structure
>3qzr_A 3C protein; chymotrypsin-fold, beta-ribbon, hydrolysis, nucleus, hydrola hydrolase inhibitor complex; HET: AG7; 1.04A {Human enterovirus 71} SCOP: b.47.1.0 PDB: 3osy_A 3qzq_A* 3r0f_A* 3sjo_A* 3sjk_A 3sji_A* 3sj8_A* 3sj9_A Back     alignment and structure
>3zve_A 3C protease; hydrolase, michael inhibitor; HET: G84; 1.80A {Human enterovirus} PDB: 3zv8_A* 3zva_A* 3zvb_A* 3zv9_A* 3zvd_A* 3zvc_A* 3zvf_A* 3zvg_A* Back     alignment and structure
>2hal_A Hepatitis A protease 3C; 3C protease, inhibitor design; HET: BBL; 1.35A {Hepatitis a virus} SCOP: b.47.1.4 PDB: 2h6m_A* 2h9h_A* 2cxv_A* 2a4o_A* 1hav_A 1qa7_A* Back     alignment and structure
>3q3y_A HEVB EV93 3C protease; cysteine trypsin-like protease, 3C cysteine protease (picorn antiviral compound 1 (AG7404); HET: XNV; 1.32A {Human enterovirus B} SCOP: b.47.1.4 PDB: 3q3x_A* 3ruo_A* 3zyd_A 3zz5_A* 3zz6_A* 3zz7_A* 3zz8_A* 3zz9_A* 3zza_A* 3zzb_A* 2ztx_A 2vb0_A 2zty_A 2ztz_A 2zu3_A* 3zye_A 3zz3_A 2zu1_A 3zz4_A 3zzc_A* ... Back     alignment and structure
>4dcd_A Protease 3C, genome polyprotein; antiviral inhibitors, dipeptidyl inhib hydrolase-hydrolase inhibitor complex; HET: K36; 1.69A {Human poliovirus 1} PDB: 1l1n_A Back     alignment and structure
>2b0f_A Picornain 3C (protease 3C) (P3C); beta barrel, hydrolase-hydrolase inhibitor complex; HET: CA1; NMR {Human rhinovirus 14} PDB: 2in2_A Back     alignment and structure
>1cqq_A Type 2 rhinovirus 3C protease; viral protein, hydrolase; HET: AG7; 1.85A {Human rhinovirus 2} SCOP: b.47.1.4 PDB: 2xya_A* Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>2ijd_1 Picornain 3C, RNA-directed RNA polymerase; RNA-dependent RNA polymerase, picornavirus, protease, hydrolase, transferase; 3.40A {Human poliovirus 1} SCOP: b.47.1.4 e.8.1.4 Back     alignment and structure
>4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} Back     alignment and structure
>2fyq_A Chymotrypsin-like cysteine proteinase; protease, norovirus, calicivirus, viral protein; 1.50A {Norwalk virus} PDB: 2fyr_A 2iph_A* 1wqs_A* Back     alignment and structure
>2fom_B Polyprotein; flavivirus, NS3 protease, NS2B cofactor, viral protein-prote complex; 1.50A {Dengue virus 2} SCOP: b.47.1.3 PDB: 1df9_A 2qid_A 1bef_A Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>3u1j_B Serine protease NS3; serine protease, ER MEM hydrolase-hydrolase inhibitor complex; 1.80A {Dengue virus 3} SCOP: b.47.1.3 PDB: 3u1i_B Back     alignment and structure
>2fp7_B Serine protease NS3; flavivirus, NS3 protease, NS2B cofactor; HET: OAR; 1.68A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>2ggv_B NS3, non-structural protein 3; beta barrel, serine protease, viral protease, flavivirus, hydrolase; 1.80A {West nile virus} PDB: 2ijo_B Back     alignment and structure
>4agk_A Capsid protein, coat protein, C; hydrolase, viral protein; 1.81A {Aura virus} PDB: 4agj_A 1kxa_A 2snw_A 1svp_A 1kxb_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>3e90_B NS3 protease; trypsin-like serine protease, protease inhibitor, catalytic histidine, induced FIT, ATP-binding, capsid protein, helicase; HET: NKK; 2.45A {West nile virus} SCOP: b.47.1.3 Back     alignment and structure
>2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Back     alignment and structure
>1ep5_B Capsid protein C, coat protein C; beta barrel, hydrolase; 2.30A {Venezuelan equine encephalitis virus} SCOP: b.47.1.3 PDB: 1ep6_A 3j0c_C Back     alignment and structure
>1svp_A Sindbis virus capsid protein; chymotrypsin-like serine, mutant, coat protein, viral protein; 2.00A {Sindbis virus} SCOP: b.47.1.3 PDB: 1kxb_A 1kxa_A 2snw_A 1kxc_A 1kxd_A 1kxe_A 2snv_A 1z8y_Q 1wyk_A Back     alignment and structure
>1vcp_A Semliki forest virus capsid protein; virus coat protein, polyprotein, transmembrane, glycoprotein, nucleocapsid protein, viral protein; 3.00A {Semliki forest virus} SCOP: b.47.1.3 PDB: 1dyl_A 1vcq_A Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Back     alignment and structure
>3lkw_A Fusion protein of nonstructural protein 2B and nonstructural protein 3; viral protease, serine protease, NS3 protease, NS2B cofactor; 2.00A {Dengue virus 1} PDB: 3l6p_A Back     alignment and structure
>3su6_A NS3 protease, NS4A protein; drug resistance, drug design, protease inhibitors, serine PR viral protein, hydrolase-inhibitor complex; HET: SU3; 1.10A {Hepatitis c virus} PDB: 3su2_A* 3sv9_A* 3m5l_A* 3m5m_A* 3m5n_A 3m5o_A 3rc4_A 3rc5_A 3rc6_A 3su3_A* 3su4_A* 3sv6_A* 3sv7_A* 3su1_A* 3su5_A* 3sv8_A* 3su0_A* 2p59_A* 2qv1_A 1a1q_A ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 314
d2z9ia2221 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tu 4e-38
d1l1ja_228 b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic 2e-35
d1lcya2205 b.47.1.1 (A:6-210) Mitochondrial serine protease H 2e-34
d1ky9a2249 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), cata 9e-32
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 6e-31
d2bhga1199 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 4e-30
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 2e-29
d2qaaa1185 b.47.1.1 (A:16-242) Protease B {Streptomyces grise 1e-26
d2sgaa_181 b.47.1.1 (A:) Protease A {Streptomyces griseus, st 2e-26
d2qf3a1210 b.47.1.1 (A:43-252) Stress sensor protease DegS, c 5e-26
d2h5ca1198 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobac 5e-25
d1lvmb_219 b.47.1.3 (B:) TEV protease (nucleat inclusion prot 2e-19
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 6e-17
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 5e-14
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 2e-09
d1cqqa_180 b.47.1.4 (A:) 3C cysteine protease (picornain 3C) 0.003
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 221 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease PepD
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  132 bits (333), Expect = 4e-38
 Identities = 78/239 (32%), Positives = 105/239 (43%), Gaps = 31/239 (12%)

Query: 78  VVQLFQETSPSVVSIQDLELSKNPKSTSSELMLVDGEYAKVEGTGSGFVWDKFGHIVTNY 137
           V Q+  +  PSVV ++                    +  +    GSG +    G I+TN 
Sbjct: 3   VEQVAAKVVPSVVMLE-------------------TDLGRQSEEGSGIILSAEGLILTNN 43

Query: 138 HVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVL 197
           HV+A  A    G    K ++  + G         V          +        L P+ L
Sbjct: 44  HVIAAAAKPPLGSPPPKTTVTFSDGRTAPF---TVVGADPTSDIAVVRVQGVSGLTPISL 100

Query: 198 GTSHDLRVGQSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNG----RAIRGAIQTDAAIN 253
           G+S DLRVGQ   AIG+P G E T+TTG+VS L R + +         +  AIQTDAAIN
Sbjct: 101 GSSSDLRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTTGEAGNQNTVLDAIQTDAAIN 160

Query: 254 SGNSGGPLMNSFGHVIGVNTATFTRKG-----TGLSSGVNFAIPIDTVVRTVPYLIVYG 307
            GNSGG L+N    ++GVN+A  T           S G+ FAIP+D   R    LI  G
Sbjct: 161 PGNSGGALVNMNAQLVGVNSAIATLGADSADAQSGSIGLGFAIPVDQAKRIADELISTG 219
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Length = 228 Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Length = 249 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Length = 199 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 185 Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 181 Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Length = 198 Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Length = 219 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query314
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 100.0
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 100.0
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 100.0
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 100.0
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 100.0
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.92
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 99.91
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.87
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.83
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.81
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 99.8
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.75
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.71
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 99.7
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.58
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 99.5
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 99.49
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 99.47
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 99.47
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 99.46
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 99.46
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 99.44
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 99.44
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 99.43
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 99.43
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 99.42
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 99.41
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 99.41
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 99.4
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 99.4
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 99.4
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 99.38
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 99.37
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 99.37
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 99.36
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 99.35
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 99.33
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 99.32
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 99.32
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 99.32
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 99.31
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 99.31
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.31
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.31
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 99.3
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 99.3
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 99.29
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 99.29
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 99.29
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.28
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 99.28
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 99.27
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 99.27
d1elva1259 Complement C1S protease, catalytic domain {Human ( 99.27
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 99.27
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 99.25
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 99.25
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 99.21
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 99.21
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 99.19
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 99.19
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 99.18
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 99.17
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 99.16
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 99.14
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 98.2
d1mbma_198 NSP4 proteinase {Equine arteritis virus, EAV [TaxI 97.64
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 97.63
d2fomb1150 NS3 protease {Dengue virus type 2 [TaxId: 11060]} 95.58
d2fp7b1152 NS3 protease {West nile virus [TaxId: 11082]} 95.18
d1ep5a_156 Viral capsid protein {Venezuelan equine encephalit 93.96
d1wyka_152 Viral capsid protein {Sindbis virus [TaxId: 11034] 93.95
d1vcpa_149 Viral capsid protein {Semliki forest virus [TaxId: 93.71
g1dy9.1187 NS3 protease {Human hepatitis C virus (HCV), diffe 80.89
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Prokaryotic proteases
domain: Protease Do (DegP, HtrA), catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=9.8e-38  Score=273.96  Aligned_cols=216  Identities=37%  Similarity=0.555  Sum_probs=168.8

Q ss_pred             HHHHHHHHhCCceEEEEeeeeecCCCCCcc----chh-------------------------hccccCCcccceEEEEEE
Q 021321           77 RVVQLFQETSPSVVSIQDLELSKNPKSTSS----ELM-------------------------LVDGEYAKVEGTGSGFVW  127 (314)
Q Consensus        77 ~~~~~~~~~~~svV~I~~~~~~~~~~~~~~----~~~-------------------------~~~~~~~~~~~~GsGfiI  127 (314)
                      +++++++++.||||.|.+............    .++                         ....+.....+.||||+|
T Consensus         4 s~a~~ve~v~PaVV~I~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~GSG~iI   83 (249)
T d1ky9a2           4 SLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVII   83 (249)
T ss_dssp             CSHHHHHHHGGGEEEEEEEEEEEECCCCSSCCTTCCCC---------------------------CEEEEEEEEEEEEEE
T ss_pred             ChHHHHHHhCCceEEEEEEEEEeecCCcCcchhhhccccCCcccccccccccccccccccccccccccccccccccEEEE
Confidence            467899999999999988654321110000    000                         000111233568999999


Q ss_pred             cCC-CEEEeccccccCCCcCCCCcceEEEEEecCCCCeEEEEEEEEEeCCCCcEEEEEEeeCCCccceeecCCCCCCCCC
Q 021321          128 DKF-GHIVTNYHVVAKLATDTSGLHRCKVSLFDAKGNGFYREGKMVGCDPAYDLAVLKVDVEGFELKPVVLGTSHDLRVG  206 (314)
Q Consensus       128 ~~~-g~VLT~aHvv~~~~~~~~~~~~~~v~~~~~~g~~~~~~a~v~~~d~~~DlAlL~v~~~~~~~~~~~l~~~~~~~~G  206 (314)
                      +++ ||||||+||++       +.+.+.+.+.+.+    .+.++++..|+..|+|+|+++.+ ..+++++|+++..++.|
T Consensus        84 ~~~~g~IlTn~HVv~-------~~~~~~v~~~~~~----~~~a~~~~~d~~~dlavl~i~~~-~~~~~~~l~~~~~~~~G  151 (249)
T d1ky9a2          84 DADKGYVVTNNHVVD-------NATVIKVQLSDGR----KFDAKMVGKDPRSDIALIQIQNP-KNLTAIKMADSDALRVG  151 (249)
T ss_dssp             ETTTTEEEEEHHHHT-------TEEEEEEEETTSC----EEEEEEEEEETTTTEEEEEESSC-CSCCCCCBCCGGGCCTT
T ss_pred             eccCceEEeeccccc-------cceeeeeeecccc----cccceeeEeccchhhceeeeccc-ccceEEEcCCcCcCCcC
Confidence            875 89999999999       5677788776644    78999999999999999999854 36889999988899999


Q ss_pred             CEEEEEEcCCCCCCCeEeeEEecccccccCCCCccccceEEEeeccCCCCcccceecCCCeEEEEEcccccCCCCCCccc
Q 021321          207 QSCFAIGNPYGFEDTLTTGVVSGLGREIPSPNGRAIRGAIQTDAAINSGNSGGPLMNSFGHVIGVNTATFTRKGTGLSSG  286 (314)
Q Consensus       207 ~~v~~iG~p~~~~~~~~~G~vs~~~~~~~~~~~~~~~~~i~~~~~~~~G~SGGPl~n~~G~vvGI~s~~~~~~~~~~~~~  286 (314)
                      ++|+++|||++...+++.+.++...+....  ......+|++|+.+.+|+|||||||.+|+||||+++.....  +...+
T Consensus       152 ~~v~aiG~P~g~~~tvt~~~~~~~~~~~~~--~~~~~~~iqtda~i~~GnSGGPl~n~~G~vIGI~t~~~~~~--~~~~g  227 (249)
T d1ky9a2         152 DYTVAIGNPFGLGETVTSGIVSALGRSGLN--AENYENFIQTDAAINRGNAGGALVNLNGELIGINTAILAPD--GGNIG  227 (249)
T ss_dssp             CEEEEEECTTSSSCEEEEEEEEEESSCC-------CCCCEEESCCCTTSCCCSEEECTTSCEEEEEECSSTTS--CCCSS
T ss_pred             CEEEEEecccccCCceeecceeeccccccc--CccccceEEEeeeecCCCCCceEECCCCEEEEEEEEEeccC--CCccc
Confidence            999999999999999999999877654322  22335689999999999999999999999999999986553  33578


Q ss_pred             eEEEEehHHHHHHHHHHHHcCc
Q 021321          287 VNFAIPIDTVVRTVPYLIVYGT  308 (314)
Q Consensus       287 ~~~aipi~~i~~~l~~l~~~~~  308 (314)
                      ++||||++.+++++++|+++|+
T Consensus       228 i~faIP~~~~~~~~~~l~~~G~  249 (249)
T d1ky9a2         228 IGFAIPSNMVKNLTSQMVEYGQ  249 (249)
T ss_dssp             SEEEEEHHHHHHHHHHHHHHSS
T ss_pred             EEEEEEHHHHHHHHHHHHHhCc
Confidence            9999999999999999999885
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d1mbma_ b.47.1.3 (A:) NSP4 proteinase {Equine arteritis virus, EAV [TaxId: 11047]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure
>d2fomb1 b.47.1.3 (B:18-167) NS3 protease {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2fp7b1 b.47.1.3 (B:19-170) NS3 protease {West nile virus [TaxId: 11082]} Back     information, alignment and structure
>d1ep5a_ b.47.1.3 (A:) Viral capsid protein {Venezuelan equine encephalitis virus [TaxId: 11036]} Back     information, alignment and structure
>d1wyka_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]} Back     information, alignment and structure
>d1vcpa_ b.47.1.3 (A:) Viral capsid protein {Semliki forest virus [TaxId: 11033]} Back     information, alignment and structure