Citrus Sinensis ID: 021360


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
MAQPLKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKTIVSLT
ccccccccccEEEEEccccccccHHHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEccccHHHHHHHHHHcccccccccEEEccccccccccccHHHHHHHHHcccccccEEEEEcccHHHHHHHHcccEEEEEccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEccccccccccccccccc
ccccccccEEEEEEEcccEEEccHHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHcHHHHccEEcccccccccccccHHHHHHHHHccccHHHEEEEEccHHHHHHHHHHccEEEEEccccccHHHHHHHHHHHHcHHHccHHHccccccHHHHccccccccEEEEEEcEccccccHHHHccccEEccHHHHHccccccccEEEEEEEEEcccccEEEEEEEEEccccccccEEEEEcc
MAQPLKKLMSCVILdldgtllntdgMFSEVLKTFLVKYgkewdgrekhkivgktpLEEAAIIVEdyglpcakhefVNEVYSMFSDHLCKVKALPGANRLIKHLschgvpmalasnshratieskisyqhgwnesFSVIVgsdevrtgkpspdIFLEAAKrlnmepssslviedsvIGVVAGKAAGMevvavpslpkqthrytAADEVINSLLdlrpekwglppfqdwiegtlpsepwyiggpvvkglgrgskvlgiptanlstegysdvlsehpsgvyfgwaglstrGVYKMVMSigwnpyfdnAEKTIVSLT
MAQPLKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVkygkewdgrekhkivgktplEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRlnmepssslviEDSVIGVVAGKAAGMEVVAvpslpkqthrytAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGwnpyfdnaeKTIVSLT
MAQPLKKLMSCVIldldgtllntdgMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKTIVSLT
*******LMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSD**********IFL************SLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKT*****
*****KKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKTI****
MAQPLKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKTIVSLT
****LKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKTIVS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQPLKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKTIVSLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query313 2.2.26 [Sep-21-2011]
Q08623228 Pseudouridine-5'-monophos yes no 0.683 0.938 0.399 2e-34
Q9D5U5234 Pseudouridine-5'-monophos yes no 0.686 0.918 0.388 2e-32
Q94529231 Probable pseudouridine-5' no no 0.696 0.943 0.373 1e-30
O14165249 Uncharacterized protein C yes no 0.686 0.863 0.284 6e-19
O59760236 Putative uncharacterized no no 0.629 0.834 0.299 2e-16
O76206153 Putative riboflavin kinas no no 0.236 0.483 0.5 2e-16
Q86ZR7236 Putative uncharacterized yes no 0.693 0.919 0.3 8e-16
O33513227 Protein CbbY OS=Rhodobact no no 0.613 0.845 0.283 1e-15
Q8CFV9155 Riboflavin kinase OS=Mus no no 0.249 0.503 0.461 2e-15
Q9X0Y1216 Phosphorylated carbohydra yes no 0.562 0.814 0.301 2e-15
>sp|Q08623|HDHD1_HUMAN Pseudouridine-5'-monophosphatase OS=Homo sapiens GN=HDHD1 PE=1 SV=3 Back     alignment and function desciption
 Score =  146 bits (368), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/218 (39%), Positives = 125/218 (57%), Gaps = 4/218 (1%)

Query: 12  VILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCA 71
           +I D+DG LL+T+ ++S V +    +Y K++    K  ++GK  LE A II++   LP +
Sbjct: 11  LIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMS 70

Query: 72  KHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGW 131
           K E V E  +   +       +PGA +LI HL  HG+P ALA++S  A+ + K S    +
Sbjct: 71  KEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEF 130

Query: 132 NESFS-VIVGSD-EVRTGKPSPDIFLEAAKRLNMEPS--SSLVIEDSVIGVVAGKAAGME 187
              FS +++G D EV+ GKP PDIFL  AKR +  P+    LV ED+  GV A  AAGM+
Sbjct: 131 FSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQ 190

Query: 188 VVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQ 225
           VV VP         T A  V+NSL D +PE +GLP ++
Sbjct: 191 VVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE 228




Dephosphorylates pseudouridine 5'-phosphate, a potential intermediate in rRNA degradation. Pseudouridine is then excreted intact in urine.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: nEC: 6
>sp|Q9D5U5|HDHD1_MOUSE Pseudouridine-5'-monophosphatase OS=Mus musculus GN=Hdhd1 PE=2 SV=1 Back     alignment and function description
>sp|Q94529|GS1_DROME Probable pseudouridine-5'-monophosphatase OS=Drosophila melanogaster GN=Gs1l PE=2 SV=2 Back     alignment and function description
>sp|O14165|YDX1_SCHPO Uncharacterized protein C4C5.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.01 PE=3 SV=2 Back     alignment and function description
>sp|O59760|YJM7_SCHPO Putative uncharacterized hydrolase C1020.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.07 PE=3 SV=1 Back     alignment and function description
>sp|O76206|RIFK_DROME Putative riboflavin kinase OS=Drosophila melanogaster GN=anon-84Ea PE=2 SV=1 Back     alignment and function description
>sp|Q86ZR7|YKD3A_YEAST Putative uncharacterized hydrolase YKL033W-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL033W-A PE=1 SV=2 Back     alignment and function description
>sp|O33513|CBBY_RHOCA Protein CbbY OS=Rhodobacter capsulatus GN=cbbY PE=3 SV=1 Back     alignment and function description
>sp|Q8CFV9|RIFK_MOUSE Riboflavin kinase OS=Mus musculus GN=Rfk PE=2 SV=2 Back     alignment and function description
>sp|Q9X0Y1|P1254_THEMA Phosphorylated carbohydrates phosphatase TM_1254 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_1254 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
255567401382 riboflavin kinase/fmn adenylyltransferas 0.987 0.808 0.783 1e-142
356521303377 PREDICTED: pseudouridine-5'-monophosphat 0.971 0.806 0.769 1e-137
224082356382 predicted protein [Populus trichocarpa] 0.987 0.808 0.763 1e-136
297804002380 ATFMN [Arabidopsis lyrata subsp. lyrata] 0.987 0.813 0.747 1e-136
224066785381 predicted protein [Populus trichocarpa] 0.984 0.808 0.763 1e-136
359495472388 PREDICTED: pseudouridine-5'-monophosphat 0.984 0.793 0.756 1e-136
359495493388 PREDICTED: pseudouridine-5'-monophosphat 0.984 0.793 0.75 1e-134
42567011379 riboflavin kinase [Arabidopsis thaliana] 0.987 0.815 0.741 1e-134
357475891377 Riboflavin kinase [Medicago truncatula] 0.971 0.806 0.753 1e-133
147846786 891 hypothetical protein VITISV_023071 [Viti 0.996 0.350 0.718 1e-133
>gi|255567401|ref|XP_002524680.1| riboflavin kinase/fmn adenylyltransferase, putative [Ricinus communis] gi|223536041|gb|EEF37699.1| riboflavin kinase/fmn adenylyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 242/309 (78%), Positives = 269/309 (87%)

Query: 1   MAQPLKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAA 60
           MA PLKK +SCVILDLDGTLLNTDG+ S++LK FLVKYGK+WDGRE ++IVGKTP E AA
Sbjct: 3   MANPLKKFVSCVILDLDGTLLNTDGIVSDILKVFLVKYGKQWDGREGNRIVGKTPFEAAA 62

Query: 61  IIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRAT 120
            IVEDY LPC   EF+ E+  MFSD  CK+K LPGANRLIKH   H VPMALASNS RA 
Sbjct: 63  TIVEDYKLPCPTEEFIAEITPMFSDQWCKIKPLPGANRLIKHFIGHNVPMALASNSPRAN 122

Query: 121 IESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVA 180
           IE+KIS   GW ESFS+I+G DEV+ GKPSP+IFLEAA+RLN+EPSS LVIEDS+ GV+ 
Sbjct: 123 IEAKISCHEGWKESFSIIIGGDEVKAGKPSPEIFLEAARRLNIEPSSCLVIEDSLPGVMG 182

Query: 181 GKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIG 240
           GKAAGMEVVAVPS+PKQ+H YTAADEVINSLLDL+PEKWGLP F+DW+EGTLP EPW+IG
Sbjct: 183 GKAAGMEVVAVPSIPKQSHLYTAADEVINSLLDLQPEKWGLPAFEDWVEGTLPVEPWHIG 242

Query: 241 GPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNP 300
           GPVVKG GRGSKVLGIPTANLSTEGYS VLS+HPSGVYFGWA LSTRGVYKMVMSIGWNP
Sbjct: 243 GPVVKGFGRGSKVLGIPTANLSTEGYSAVLSQHPSGVYFGWAALSTRGVYKMVMSIGWNP 302

Query: 301 YFDNAEKTI 309
           YF+N EKTI
Sbjct: 303 YFNNVEKTI 311




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356521303|ref|XP_003529296.1| PREDICTED: pseudouridine-5'-monophosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|224082356|ref|XP_002306660.1| predicted protein [Populus trichocarpa] gi|222856109|gb|EEE93656.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297804002|ref|XP_002869885.1| ATFMN [Arabidopsis lyrata subsp. lyrata] gi|297315721|gb|EFH46144.1| ATFMN [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224066785|ref|XP_002302214.1| predicted protein [Populus trichocarpa] gi|222843940|gb|EEE81487.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359495472|ref|XP_003634998.1| PREDICTED: pseudouridine-5'-monophosphatase-like [Vitis vinifera] gi|302144187|emb|CBI23314.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495493|ref|XP_002271233.2| PREDICTED: pseudouridine-5'-monophosphatase [Vitis vinifera] gi|302144186|emb|CBI23313.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|42567011|ref|NP_193878.2| riboflavin kinase [Arabidopsis thaliana] gi|30102526|gb|AAP21181.1| At4g21470 [Arabidopsis thaliana] gi|62752481|gb|AAX98488.1| riboflavin kinase/FMN hydrolase [Arabidopsis thaliana] gi|110742726|dbj|BAE99274.1| hypothetical protein [Arabidopsis thaliana] gi|332659057|gb|AEE84457.1| riboflavin kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357475891|ref|XP_003608231.1| Riboflavin kinase [Medicago truncatula] gi|217072412|gb|ACJ84566.1| unknown [Medicago truncatula] gi|355509286|gb|AES90428.1| Riboflavin kinase [Medicago truncatula] gi|388509552|gb|AFK42842.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|147846786|emb|CAN78503.1| hypothetical protein VITISV_023071 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
TAIR|locus:2119647379 FMN/FHY "riboflavin kinase/FMN 0.987 0.815 0.708 1.6e-118
TAIR|locus:2174567240 GS1 [Arabidopsis thaliana (tax 0.629 0.820 0.395 1.3e-31
UNIPROTKB|E2R8L4233 HDHD1 "Uncharacterized protein 0.635 0.854 0.384 2.3e-30
TAIR|locus:2117512298 GPP1 "glycerol-3-phosphatase 1 0.629 0.661 0.376 3e-30
UNIPROTKB|Q08623228 HDHD1 "Pseudouridine-5'-monoph 0.638 0.877 0.392 7.9e-30
UNIPROTKB|Q2KJ86231 HDHD1A "Haloacid dehalogenase- 0.635 0.861 0.369 1.7e-27
MGI|MGI:1914615234 Hdhd1a "haloacid dehalogenase- 0.642 0.858 0.375 1.7e-27
FB|FBgn0019982231 Gs1l "GS1-like" [Drosophila me 0.693 0.939 0.354 1.2e-26
UNIPROTKB|E1BRK1214 HDHD1 "Uncharacterized protein 0.635 0.929 0.344 3.2e-26
RGD|1305101234 Hdhd1 "haloacid dehalogenase-l 0.642 0.858 0.356 4e-26
TAIR|locus:2119647 FMN/FHY "riboflavin kinase/FMN hydrolase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1167 (415.9 bits), Expect = 1.6e-118, P = 1.6e-118
 Identities = 219/309 (70%), Positives = 250/309 (80%)

Query:     1 MAQPLKKLMSCVIXXXXXXXXXXXXMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAA 60
             M+  LKKL SCV+            +  ++L+ +L KYGK+WDGRE  KIVGKTP+E A 
Sbjct:     3 MSNSLKKLSSCVLIDLDGTLINTDGVVGDILRKYLCKYGKQWDGRESLKIVGKTPVEAAT 62

Query:    61 IIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRAT 120
              IVEDY LPC   EF +E Y +FS  + K+K+LPGANRLI+HL CHGVP+ALASNS RA 
Sbjct:    63 TIVEDYELPCKVDEFNSEFYPLFSAQMDKIKSLPGANRLIRHLKCHGVPVALASNSSRAN 122

Query:   121 IESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVA 180
             IESKISY  GW E FSVIVGSDEV  GKPSPDIFLEAAKRL  +P+  LVIEDSV GV+A
Sbjct:   123 IESKISYHEGWKECFSVIVGSDEVSKGKPSPDIFLEAAKRLKKDPADCLVIEDSVPGVMA 182

Query:   181 GKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIG 240
             GKAAG +V+AVPSLPKQTH YT+ADEVINSLLD+R EKWGLPPFQDWIE TLP +PW+IG
Sbjct:   183 GKAAGTKVIAVPSLPKQTHLYTSADEVINSLLDIRLEKWGLPPFQDWIENTLPIDPWHIG 242

Query:   241 GPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNP 300
             GPV+KG GRGSKVLGIPTANLST+ Y+D L EHPSGVYFGWAGL+ RGV+KMVMSIGWNP
Sbjct:   243 GPVIKGFGRGSKVLGIPTANLSTKDYADELVEHPSGVYFGWAGLAKRGVFKMVMSIGWNP 302

Query:   301 YFDNAEKTI 309
             YF+N EKTI
Sbjct:   303 YFNNKEKTI 311




GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0008531 "riboflavin kinase activity" evidence=IEA;ISS;IDA
GO:0009231 "riboflavin biosynthetic process" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
GO:0003919 "FMN adenylyltransferase activity" evidence=IDA
GO:0016036 "cellular response to phosphate starvation" evidence=RCA
GO:0019375 "galactolipid biosynthetic process" evidence=RCA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2174567 GS1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8L4 HDHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2117512 GPP1 "glycerol-3-phosphatase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q08623 HDHD1 "Pseudouridine-5'-monophosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ86 HDHD1A "Haloacid dehalogenase-like hydrolase domain containing 1A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1914615 Hdhd1a "haloacid dehalogenase-like hydrolase domain containing 1A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0019982 Gs1l "GS1-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BRK1 HDHD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1305101 Hdhd1 "haloacid dehalogenase-like hydrolase domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer2.7.1LOW CONFIDENCE prediction!
4th Layer2.7.1.26LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_Genewise1_v1.C_LG_V0054
riboflavin kinase (EC-2.7.1.26) (383 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.142.26.1
SubName- Full=Putative uncharacterized protein; (231 aa)
       0.899
gw1.120.130.1
riboflavin synthase (EC-2.5.1.9) (205 aa)
       0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
PLN02940382 PLN02940, PLN02940, riboflavin kinase 0.0
PLN02811220 PLN02811, PLN02811, hydrolase 2e-58
COG0637221 COG0637, COG0637, Predicted phosphatase/phosphohex 4e-40
TIGR02009185 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase f 2e-29
TIGR01990185 TIGR01990, bPGM, beta-phosphoglucomutase 3e-26
COG0546220 COG0546, Gph, Predicted phosphatases [General func 6e-26
pfam13419176 pfam13419, HAD_2, Haloacid dehalogenase-like hydro 5e-25
TIGR01509177 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase sup 7e-25
COG1011229 COG1011, COG1011, Predicted hydrolase (HAD superfa 1e-19
pfam00702187 pfam00702, Hydrolase, haloacid dehalogenase-like h 9e-19
PRK10725188 PRK10725, PRK10725, fructose-1-P/6-phosphogluconat 9e-19
pfam01687125 pfam01687, Flavokinase, Riboflavin kinase 4e-18
PRK10826222 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; 7e-17
PLN02779286 PLN02779, PLN02779, haloacid dehalogenase-like hyd 1e-16
smart00904124 smart00904, Flavokinase, Riboflavin kinase 2e-16
PRK13222226 PRK13222, PRK13222, phosphoglycolate phosphatase; 6e-16
PRK11587218 PRK11587, PRK11587, putative phosphatase; Provisio 8e-16
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydr 5e-15
PLN02919 1057 PLN02919, PLN02919, haloacid dehalogenase-like hyd 1e-14
TIGR01454205 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic 4e-14
PLN02770248 PLN02770, PLN02770, haloacid dehalogenase-like hyd 3e-13
TIGR01449213 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatas 4e-13
PLN02575381 PLN02575, PLN02575, haloacid dehalogenase-like hyd 2e-12
PLN03243260 PLN03243, PLN03243, haloacid dehalogenase-like hyd 5e-12
COG0196304 COG0196, RibF, FAD synthase [Coenzyme metabolism] 9e-12
TIGR02253221 TIGR02253, CTE7, HAD superfamily (subfamily IA) hy 2e-11
pfam1324274 pfam13242, Hydrolase_like, HAD-hyrolase-like 2e-11
PRK10563221 PRK10563, PRK10563, 6-phosphogluconate phosphatase 7e-11
TIGR01549162 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase sup 9e-11
PRK13288214 PRK13288, PRK13288, pyrophosphatase PpaX; Provisio 1e-10
PRK13223272 PRK13223, PRK13223, phosphoglycolate phosphatase; 2e-09
TIGR03351220 TIGR03351, PhnX-like, phosphonatase-like hydrolase 5e-09
TIGR02252203 TIGR02252, DREG-2, REG-2-like, HAD superfamily (su 6e-08
PRK05627305 PRK05627, PRK05627, bifunctional riboflavin kinase 2e-07
PRK13226229 PRK13226, PRK13226, phosphoglycolate phosphatase; 5e-07
TIGR00213176 TIGR00213, GmhB_yaeD, D,D-heptose 1,7-bisphosphate 5e-06
TIGR00083288 TIGR00083, ribF, riboflavin kinase/FMN adenylyltra 3e-05
TIGR01656147 TIGR01656, Histidinol-ppas, histidinol-phosphate p 4e-05
TIGR01422253 TIGR01422, phosphonatase, phosphonoacetaldehyde hy 7e-05
COG0241181 COG0241, HisB, Histidinol phosphatase and related 1e-04
TIGR01458257 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfam 4e-04
PRK13225273 PRK13225, PRK13225, phosphoglycolate phosphatase; 6e-04
COG0647269 COG0647, NagD, Predicted sugar phosphatases of the 7e-04
PRK08942181 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate p 0.001
TIGR01993183 TIGR01993, Pyr-5-nucltdase, pyrimidine 5'-nucleoti 0.002
PRK13478267 PRK13478, PRK13478, phosphonoacetaldehyde hydrolas 0.002
TIGR02254224 TIGR02254, YjjG/YfnB, HAD superfamily (subfamily I 0.002
>gnl|CDD|178528 PLN02940, PLN02940, riboflavin kinase Back     alignment and domain information
 Score =  579 bits (1494), Expect = 0.0
 Identities = 248/309 (80%), Positives = 273/309 (88%)

Query: 1   MAQPLKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAA 60
            A+PLKKL+S VILDLDGTLLNTDG+ S+VLK FLVKYGK+WDGRE  KIVGKTPLE AA
Sbjct: 3   AAKPLKKLVSHVILDLDGTLLNTDGIVSDVLKAFLVKYGKQWDGREAQKIVGKTPLEAAA 62

Query: 61  IIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRAT 120
            +VEDYGLPC+  EF +E+  + S+  C +KALPGANRLIKHL  HGVPMALASNS RA 
Sbjct: 63  TVVEDYGLPCSTDEFNSEITPLLSEQWCNIKALPGANRLIKHLKSHGVPMALASNSPRAN 122

Query: 121 IESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVA 180
           IE+KIS   GW ESFSVIVG DEV  GKPSPDIFLEAAKRLN+EPS+ LVIEDS+ GV+A
Sbjct: 123 IEAKISCHQGWKESFSVIVGGDEVEKGKPSPDIFLEAAKRLNVEPSNCLVIEDSLPGVMA 182

Query: 181 GKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWYIG 240
           GKAAGMEV+AVPS+PKQTH Y++ADEVINSLLDL+PEKWGLPPF DWIEGTLP EPW+IG
Sbjct: 183 GKAAGMEVIAVPSIPKQTHLYSSADEVINSLLDLQPEKWGLPPFNDWIEGTLPIEPWHIG 242

Query: 241 GPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNP 300
           GPV+KG GRGSKVLGIPTANLSTE YSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNP
Sbjct: 243 GPVIKGFGRGSKVLGIPTANLSTENYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNP 302

Query: 301 YFDNAEKTI 309
           YF+N EKTI
Sbjct: 303 YFNNTEKTI 311


Length = 382

>gnl|CDD|178407 PLN02811, PLN02811, hydrolase Back     alignment and domain information
>gnl|CDD|223710 COG0637, COG0637, Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213673 TIGR02009, PGMB-YQAB-SF, beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>gnl|CDD|213672 TIGR01990, bPGM, beta-phosphoglucomutase Back     alignment and domain information
>gnl|CDD|223620 COG0546, Gph, Predicted phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|222115 pfam13419, HAD_2, Haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|233443 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>gnl|CDD|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|182679 PRK10725, PRK10725, fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|190069 pfam01687, Flavokinase, Riboflavin kinase Back     alignment and domain information
>gnl|CDD|236770 PRK10826, PRK10826, 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215416 PLN02779, PLN02779, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|214901 smart00904, Flavokinase, Riboflavin kinase Back     alignment and domain information
>gnl|CDD|237310 PRK13222, PRK13222, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|183215 PRK11587, PRK11587, putative phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|215497 PLN02919, PLN02919, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|130521 TIGR01454, AHBA_synth_RP, 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>gnl|CDD|215413 PLN02770, PLN02770, haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>gnl|CDD|130516 TIGR01449, PGP_bact, 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>gnl|CDD|215313 PLN02575, PLN02575, haloacid dehalogenase-like hydrolase Back     alignment and domain information
>gnl|CDD|215644 PLN03243, PLN03243, haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|223274 COG0196, RibF, FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>gnl|CDD|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like Back     alignment and domain information
>gnl|CDD|182552 PRK10563, PRK10563, 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233463 TIGR01549, HAD-SF-IA-v1, haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>gnl|CDD|237336 PRK13288, PRK13288, pyrophosphatase PpaX; Provisional Back     alignment and domain information
>gnl|CDD|171912 PRK13223, PRK13223, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|234176 TIGR03351, PhnX-like, phosphonatase-like hydrolase Back     alignment and domain information
>gnl|CDD|200170 TIGR02252, DREG-2, REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>gnl|CDD|235536 PRK05627, PRK05627, bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|237311 PRK13226, PRK13226, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|129317 TIGR00213, GmhB_yaeD, D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>gnl|CDD|232818 TIGR00083, ribF, riboflavin kinase/FMN adenylyltransferase Back     alignment and domain information
>gnl|CDD|233512 TIGR01656, Histidinol-ppas, histidinol-phosphate phosphatase family domain Back     alignment and domain information
>gnl|CDD|188140 TIGR01422, phosphonatase, phosphonoacetaldehyde hydrolase Back     alignment and domain information
>gnl|CDD|223319 COG0241, HisB, Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162372 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>gnl|CDD|106187 PRK13225, PRK13225, phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|236354 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>gnl|CDD|233675 TIGR01993, Pyr-5-nucltdase, pyrimidine 5'-nucleotidase Back     alignment and domain information
>gnl|CDD|184075 PRK13478, PRK13478, phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|162788 TIGR02254, YjjG/YfnB, HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 313
PLN02940382 riboflavin kinase 100.0
TIGR00083288 ribF riboflavin kinase/FMN adenylyltransferase. mu 100.0
PRK05627305 bifunctional riboflavin kinase/FMN adenylyltransfe 99.98
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.97
COG0637221 Predicted phosphatase/phosphohexomutase [General f 99.97
COG0196304 RibF FAD synthase [Coenzyme metabolism] 99.97
PLN02770248 haloacid dehalogenase-like hydrolase family protei 99.97
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 99.96
COG0546220 Gph Predicted phosphatases [General function predi 99.96
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 99.96
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 99.96
PRK13288214 pyrophosphatase PpaX; Provisional 99.96
PRK13226229 phosphoglycolate phosphatase; Provisional 99.96
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 99.96
PLN02575381 haloacid dehalogenase-like hydrolase 99.96
PF01687125 Flavokinase: Riboflavin kinase; InterPro: IPR01586 99.96
PRK11587218 putative phosphatase; Provisional 99.96
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 99.96
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.96
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.96
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 99.96
PRK13223272 phosphoglycolate phosphatase; Provisional 99.95
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 99.95
PRK13222226 phosphoglycolate phosphatase; Provisional 99.95
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 99.95
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 99.95
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 99.95
PLN02811220 hydrolase 99.95
PRK13225273 phosphoglycolate phosphatase; Provisional 99.95
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 99.94
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 99.94
PRK09449224 dUMP phosphatase; Provisional 99.94
PLN02779286 haloacid dehalogenase-like hydrolase family protei 99.94
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 99.94
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.93
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 99.93
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 99.93
PRK14988224 GMP/IMP nucleotidase; Provisional 99.93
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.92
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 99.91
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 99.91
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 99.9
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 99.9
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 99.9
KOG3110153 consensus Riboflavin kinase [Coenzyme transport an 99.89
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 99.89
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 99.88
PHA02597197 30.2 hypothetical protein; Provisional 99.88
PRK07143279 hypothetical protein; Provisional 99.88
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 99.87
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.84
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 99.84
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.82
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 99.81
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 99.81
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 99.8
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 99.8
PLN02954224 phosphoserine phosphatase 99.79
PRK06769173 hypothetical protein; Validated 99.79
PRK11133322 serB phosphoserine phosphatase; Provisional 99.78
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 99.77
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 99.77
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 99.76
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 99.76
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.76
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.74
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 99.7
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 99.7
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.7
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.69
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.65
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.65
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.63
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 99.63
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 99.62
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 99.61
PRK05446354 imidazole glycerol-phosphate dehydratase/histidino 99.61
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.6
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 99.6
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.58
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 99.57
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 99.57
PRK08238 479 hypothetical protein; Validated 99.56
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 99.56
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 99.55
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 99.55
PHA02530300 pseT polynucleotide kinase; Provisional 99.54
PRK11590211 hypothetical protein; Provisional 99.53
PRK10444248 UMP phosphatase; Provisional 99.5
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 99.48
PLN02645311 phosphoglycolate phosphatase 99.45
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.4
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 99.39
COG0241181 HisB Histidinol phosphatase and related phosphatas 99.38
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 99.37
COG4229229 Predicted enolase-phosphatase [Energy production a 99.37
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 99.36
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.36
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 99.35
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.35
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 99.32
COG0647269 NagD Predicted sugar phosphatases of the HAD super 99.28
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 99.27
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 99.26
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 99.25
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 99.23
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 99.21
PRK01158230 phosphoglycolate phosphatase; Provisional 99.2
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.2
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 99.16
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 99.13
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 99.1
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 99.05
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 99.05
PTZ00445219 p36-lilke protein; Provisional 99.02
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.98
KOG3040262 consensus Predicted sugar phosphatase (HAD superfa 98.98
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.97
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 98.97
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 98.94
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 98.93
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 98.9
PRK10513270 sugar phosphate phosphatase; Provisional 98.89
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 98.89
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 98.88
KOG2882306 consensus p-Nitrophenyl phosphatase [Inorganic ion 98.87
PRK10976266 putative hydrolase; Provisional 98.87
PLN02887580 hydrolase family protein 98.8
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 98.78
COG4359220 Uncharacterized conserved protein [Function unknow 98.74
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.73
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.73
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 98.72
cd02064180 FAD_synthetase_N FAD synthetase, N-terminal domain 98.68
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 98.68
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 98.63
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 98.61
PHA03398303 viral phosphatase superfamily protein; Provisional 98.59
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 98.57
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 98.57
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 98.54
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 98.5
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 98.45
KOG2630254 consensus Enolase-phosphatase E-1 [Amino acid tran 98.43
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 98.37
TIGR01675229 plant-AP plant acid phosphatase. This model explic 98.37
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 98.37
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 98.36
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 98.34
PF05761448 5_nucleotid: 5' nucleotidase family; InterPro: IPR 98.31
COG4996164 Predicted phosphatase [General function prediction 98.29
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 98.27
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 98.26
PLN02177 497 glycerol-3-phosphate acyltransferase 98.21
COG4087152 Soluble P-type ATPase [General function prediction 98.2
PLN02382413 probable sucrose-phosphatase 98.19
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 98.16
PRK10671834 copA copper exporting ATPase; Provisional 98.16
TIGR01522 884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 98.13
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.11
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 98.11
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 98.08
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 97.95
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 97.9
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 97.89
COG3700237 AphA Acid phosphatase (class B) [General function 97.86
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 97.82
COG3882574 FkbH Predicted enzyme involved in methoxymalonyl-A 97.68
COG5663194 Uncharacterized conserved protein [Function unknow 97.59
PLN02423245 phosphomannomutase 97.54
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 97.49
PLN02645311 phosphoglycolate phosphatase 97.49
PTZ00174247 phosphomannomutase; Provisional 97.49
TIGR01116 917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 97.46
COG2503274 Predicted secreted acid phosphatase [General funct 97.43
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 97.41
PRK14010673 potassium-transporting ATPase subunit B; Provision 97.37
PRK01122679 potassium-transporting ATPase subunit B; Provision 97.34
TIGR01517 941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 97.25
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 97.22
TIGR01647755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 97.2
TIGR01523 1053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 97.19
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.15
TIGR01524 867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 97.13
PRK10517 902 magnesium-transporting ATPase MgtA; Provisional 97.13
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 97.11
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 97.07
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 97.04
PRK15122 903 magnesium-transporting ATPase; Provisional 97.02
KOG2470510 consensus Similar to IMP-GMP specific 5'-nucleotid 96.99
COG0474 917 MgtA Cation transport ATPase [Inorganic ion transp 96.98
TIGR01106 997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 96.8
PLN02499 498 glycerol-3-phosphate acyltransferase 96.76
COG0647269 NagD Predicted sugar phosphatases of the HAD super 96.44
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 96.44
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 96.41
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 96.27
COG5610 635 Predicted hydrolase (HAD superfamily) [General fun 96.17
KOG0202 972 consensus Ca2+ transporting ATPase [Inorganic ion 96.14
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 96.03
COG4030315 Uncharacterized protein conserved in archaea [Func 96.0
TIGR01657 1054 P-ATPase-V P-type ATPase of unknown pump specifici 95.97
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 95.97
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 95.58
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 95.48
KOG2961190 consensus Predicted hydrolase (HAD superfamily) [G 95.47
TIGR01652 1057 ATPase-Plipid phospholipid-translocating P-type AT 94.8
COG4502180 5'(3')-deoxyribonucleotidase [Nucleotide transport 94.8
KOG2134422 consensus Polynucleotide kinase 3' phosphatase [Re 94.67
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 94.63
KOG0204 1034 consensus Calcium transporting ATPase [Inorganic i 94.21
cd02169297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 94.21
PLN03190 1178 aminophospholipid translocase; Provisional 93.68
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 93.55
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 93.28
KOG1618389 consensus Predicted phosphatase [General function 93.1
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 92.94
TIGR01658274 EYA-cons_domain eyes absent protein conserved doma 92.82
smart00764182 Citrate_ly_lig Citrate lyase ligase C-terminal dom 92.81
PLN02580384 trehalose-phosphatase 92.47
PLN03017366 trehalose-phosphatase 92.27
PLN02151354 trehalose-phosphatase 91.79
PRK10444248 UMP phosphatase; Provisional 91.73
KOG4549144 consensus Magnesium-dependent phosphatase [General 91.3
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 90.3
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 90.08
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 88.62
KOG0206 1151 consensus P-type ATPase [General function predicti 88.61
PTZ00174247 phosphomannomutase; Provisional 87.93
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 87.06
KOG2116738 consensus Protein involved in plasmid maintenance/ 86.78
TIGR01456321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 83.8
PF06574157 FAD_syn: FAD synthetase; InterPro: IPR015864 Ribof 82.82
KOG2469424 consensus IMP-GMP specific 5'-nucleotidase [Nucleo 82.79
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 81.85
PF06189264 5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103 81.83
PLN03063797 alpha,alpha-trehalose-phosphate synthase (UDP-form 80.5
>PLN02940 riboflavin kinase Back     alignment and domain information
Probab=100.00  E-value=6.6e-62  Score=434.36  Aligned_cols=313  Identities=79%  Similarity=1.286  Sum_probs=274.0

Q ss_pred             CCcc--cccCccEEEEecCCccccChHHHHHHHHHHHHHcCCCCChhhhhhhcCCCHHHHHHHHHHHhCCCCCHHHHHHH
Q 021360            1 MAQP--LKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNE   78 (313)
Q Consensus         1 M~~~--~~~~~k~vifDlDGTL~d~~~~~~~~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~   78 (313)
                      |+.+  ....+++|+||+||||+|+...+..++..+++++|...+.+......|....+.+..++..++.+...+++...
T Consensus         1 ~~~~~~~~~~ik~VIFDlDGTLvDt~~~~~~a~~~~~~~~G~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (382)
T PLN02940          1 MSAAKPLKKLVSHVILDLDGTLLNTDGIVSDVLKAFLVKYGKQWDGREAQKIVGKTPLEAAATVVEDYGLPCSTDEFNSE   80 (382)
T ss_pred             CCCCccccccCCEEEECCcCcCCcCHHHHHHHHHHHHHHcCCCCCHHHHHHhcCCCHHHHHHHHHHHhCCCCCHHHHHHH
Confidence            5543  23468999999999999999999999999999999888877778888888888888888888887777777777


Q ss_pred             HHHHHHhhhccCCCCchHHHHHHHHHHCCCCEEEEeCCchHHHHHHHHhhcCCccccceEEecCCCCCCCCChHHHHHHH
Q 021360           79 VYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAA  158 (313)
Q Consensus        79 ~~~~~~~~~~~~~~~pgv~e~l~~l~~~g~~~~i~s~~~~~~~~~~l~~~~~~~~~f~~v~~~~~~~~~kp~~~~~~~~~  158 (313)
                      +.+.+...+....++||+.++|+.|++.|++++++||++...+...+.++.++..+|+.+++++++...||+|+.+..++
T Consensus        81 ~~~~~~~~~~~~~l~pGv~elL~~Lk~~g~~l~IvTn~~~~~~~~~l~~~~gl~~~Fd~ii~~d~v~~~KP~p~~~~~a~  160 (382)
T PLN02940         81 ITPLLSEQWCNIKALPGANRLIKHLKSHGVPMALASNSPRANIEAKISCHQGWKESFSVIVGGDEVEKGKPSPDIFLEAA  160 (382)
T ss_pred             HHHHHHHHHccCCCCcCHHHHHHHHHHCCCcEEEEeCCcHHHHHHHHHhccChHhhCCEEEehhhcCCCCCCHHHHHHHH
Confidence            77777666677889999999999999999999999999999888777447899999999999999999999999999999


Q ss_pred             HHcCCCCCcEEEEecCHhhHHHHHHcCCeEEEeCCCCCccccccccceeeccccccCccccCCCCccccccCCCCCCccc
Q 021360          159 KRLNMEPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQDWIEGTLPSEPWY  238 (313)
Q Consensus       159 ~~~~~~~~~~i~vgD~~~Di~~a~~~G~~~i~v~~~~~~~~~~~~s~~ii~~l~e~~~~~~~~~~~~~~~a~~~lg~p~~  238 (313)
                      ++++++|++|++|||+..|+.+|+++|+.++++..+.........++.++.++.++....+++|++++|+.+.+|+|||.
T Consensus       161 ~~lgv~p~~~l~VGDs~~Di~aA~~aGi~~I~v~~g~~~~~~~~~ad~~i~sl~el~~~~~~~~~~~~~~~~~~~~~~y~  240 (382)
T PLN02940        161 KRLNVEPSNCLVIEDSLPGVMAGKAAGMEVIAVPSIPKQTHLYSSADEVINSLLDLQPEKWGLPPFNDWIEGTLPIEPWH  240 (382)
T ss_pred             HHcCCChhHEEEEeCCHHHHHHHHHcCCEEEEECCCCcchhhccCccEEeCCHhHcCHHHcCCCCccccccCcCCcCCEE
Confidence            99999999999999999999999999999999987543332334688999999999888899999999999999999999


Q ss_pred             cccceeeeecCCCcccCccccccCCCccccccCCCCCeEEEEEEEecCCceeEEEEEecCCccccCCcceEeecC
Q 021360          239 IGGPVVKGLGRGSKVLGIPTANLSTEGYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFDNAEKTIVSLT  313 (313)
Q Consensus       239 ~~g~v~~g~~~g~~~lg~ptan~~~~~~~~~~p~~~~gvy~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~e~~~  313 (313)
                      ++|+|+||+++||++||||||||.+++..+++|.++.||||+|+.+.++.+|+||+|||+||||++.+.+||+||
T Consensus       241 ~~G~Vv~G~~~G~~~lg~PTaNl~~~~~~~~~~~p~~GVY~~~~~~~~~~~~~~v~niG~~Pt~~~~~~~~E~~i  315 (382)
T PLN02940        241 IGGPVIKGFGRGSKVLGIPTANLSTENYSDVLSEHPSGVYFGWAGLSTRGVYKMVMSIGWNPYFNNTEKTIEPWL  315 (382)
T ss_pred             EEEEEEeCCccCcccCCCCcccCCcchhhhhcCCCCCEEEEEEEEECCCceEEEEEEecCCCccCCCccEEEEEE
Confidence            999999999999997799999999876423564226899999999843358999999999999987677899996



>TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase Back     alignment and domain information
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PF01687 Flavokinase: Riboflavin kinase; InterPro: IPR015865 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>KOG3110 consensus Riboflavin kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>cd02064 FAD_synthetase_N FAD synthetase, N-terminal domain of the bifunctional enzyme Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism] Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG5663 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>KOG0204 consensus Calcium transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>KOG1618 consensus Predicted phosphatase [General function prediction only] Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01658 EYA-cons_domain eyes absent protein conserved domain Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>KOG0206 consensus P-type ATPase [General function prediction only] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism] Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PF06574 FAD_syn: FAD synthetase; InterPro: IPR015864 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>KOG2469 consensus IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3 Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
3l5k_A250 The Crystal Structure Of Human Haloacid Dehalogenas 3e-31
1nb0_A147 Crystal Structure Of Human Riboflavin Kinase Length 1e-16
1q9s_A149 Crystal Structure Of Riboflavin Kinase With Ternary 2e-16
1n05_A163 Crystal Structure Of Schizosaccharomyces Pombe Ribo 2e-15
3e58_A214 Crystal Structure Of Putative Beta-Phosphoglucomuta 4e-11
3nas_A233 The Crystal Structure Of Beta-Phosphoglucomutase Fr 1e-10
3kbb_A216 Crystal Structure Of Putative Beta-Phosphoglucomuta 4e-10
4ex6_A237 Crystal Structure Of The Alnumycin P Phosphatase Al 4e-09
1te2_A226 Putative Phosphatase Ynic From Escherichia Coli K12 9e-09
4eek_A259 Crystal Structure Of Had Family Hydrolase Dr_1622 F 5e-08
2x0k_A338 Crystal Structure Of Modular Fad Synthetase From Co 6e-08
4gib_A250 2.27 Angstrom Crystal Structure Of Beta-Phosphogluc 6e-08
3zug_A338 E268d Mutant Of Fad Synthetase From Corynebacterium 6e-08
3dv9_A247 Putative Beta-Phosphoglucomutase From Bacteroides V 8e-08
1o03_A221 Structure Of Pentavalent Phosphorous Intermediate O 3e-07
3fm9_A221 Analysis Of The Structural Determinants Underlying 3e-07
3qub_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 3e-07
1lvh_A221 The Structure Of Phosphorylated Beta-phosphoglucomu 3e-07
3qyp_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 6e-07
3qu5_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 6e-07
3qu4_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 6e-07
3qut_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 6e-07
3quq_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 7e-07
3r9k_A243 Crystal Structure Of Pyrophosphatase From Bacteroid 7e-07
3d6j_A225 Crystal Structure Of Putative Haloacid Dehalogenase 8e-07
4g9b_A243 Crystal Structure Of Beta-Phosphoglucomutase Homolo 1e-06
2fdr_A229 Crystal Structure Of Conserved Haloacid Dehalogenas 8e-06
3bnw_A181 Crystal Structure Of Riboflavin Kinase From Trypano 2e-05
3kzx_A231 Crystal Structure Of A Had-Superfamily Hydrolase Fr 3e-05
2yy6_A213 Crystal Structure Of The Phosphoglycolate Phosphata 8e-05
2nyv_A222 X-Ray Crystal Structure Of A Phosphoglycolate Phosp 2e-04
3s6j_A233 The Crystal Structure Of A Hydrolase From Pseudomon 3e-04
2hdo_A209 Crystal Structure Of Putative Phosphoglycolate Phos 4e-04
>pdb|3L5K|A Chain A, The Crystal Structure Of Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 1a (Hdhd1a) Length = 250 Back     alignment and structure

Iteration: 1

Score = 132 bits (331), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 80/204 (39%), Positives = 114/204 (55%), Gaps = 4/204 (1%) Query: 26 MFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSD 85 ++S V + +Y K++ K ++GK LE A II++ LP +K E V E + + Sbjct: 47 LYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE 106 Query: 86 HLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFS-VIVGSD-E 143 +PGA +LI HL HG+P ALA++S A+ + K S + FS +++G D E Sbjct: 107 VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPE 166 Query: 144 VRTGKPSPDIFLEAAKRLNMEPS--SSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRY 201 V+ GKP PDIFL AKR + P+ LV ED+ GV A AAGM+VV VP Sbjct: 167 VQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLT 226 Query: 202 TAADEVINSLLDLRPEKWGLPPFQ 225 T A V+NSL D +PE +GLP ++ Sbjct: 227 TKATLVLNSLQDFQPELFGLPSYE 250
>pdb|1NB0|A Chain A, Crystal Structure Of Human Riboflavin Kinase Length = 147 Back     alignment and structure
>pdb|1Q9S|A Chain A, Crystal Structure Of Riboflavin Kinase With Ternary Product Complex Length = 149 Back     alignment and structure
>pdb|1N05|A Chain A, Crystal Structure Of Schizosaccharomyces Pombe Riboflavin Kinase Reveals A Novel Atp And Riboflavin Binding Fold Length = 163 Back     alignment and structure
>pdb|3E58|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Streptococcus Thermophilus Length = 214 Back     alignment and structure
>pdb|3NAS|A Chain A, The Crystal Structure Of Beta-Phosphoglucomutase From Bacillus Subtilis Length = 233 Back     alignment and structure
>pdb|3KBB|A Chain A, Crystal Structure Of Putative Beta-Phosphoglucomutase From Thermotoga Maritima Length = 216 Back     alignment and structure
>pdb|4EX6|A Chain A, Crystal Structure Of The Alnumycin P Phosphatase Alnb Length = 237 Back     alignment and structure
>pdb|1TE2|A Chain A, Putative Phosphatase Ynic From Escherichia Coli K12 Length = 226 Back     alignment and structure
>pdb|4EEK|A Chain A, Crystal Structure Of Had Family Hydrolase Dr_1622 From Deinococcus Radiodurans R1 (Target Efi-501256) With Bound Phosphate And Sodium Length = 259 Back     alignment and structure
>pdb|2X0K|A Chain A, Crystal Structure Of Modular Fad Synthetase From Corynebacterium Ammoniagenes Length = 338 Back     alignment and structure
>pdb|4GIB|A Chain A, 2.27 Angstrom Crystal Structure Of Beta-Phosphoglucomutase (Pgmb) From Clostridium Difficile Length = 250 Back     alignment and structure
>pdb|3ZUG|A Chain A, E268d Mutant Of Fad Synthetase From Corynebacterium Ammoniagenes Length = 338 Back     alignment and structure
>pdb|3DV9|A Chain A, Putative Beta-Phosphoglucomutase From Bacteroides Vulgatus Length = 247 Back     alignment and structure
>pdb|1O03|A Chain A, Structure Of Pentavalent Phosphorous Intermediate Of An Enzyme Catalyzed Phosphoryl Transfer Reaction Observed On Cocrystallization With Glucose 6-Phosphate Length = 221 Back     alignment and structure
>pdb|3FM9|A Chain A, Analysis Of The Structural Determinants Underlying Discrimination Between Substrate And Solvent In Beta- Phosphoglucomutase Catalysis Length = 221 Back     alignment and structure
>pdb|3QUB|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47ala Mutant Complexed With Sulfate Length = 243 Back     alignment and structure
>pdb|1LVH|A Chain A, The Structure Of Phosphorylated Beta-phosphoglucomutase From Lactoccocus Lactis To 2.3 Angstrom Resolution Length = 221 Back     alignment and structure
>pdb|3QYP|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asn Mutant Complexed With Calcium And Phosphate Length = 243 Back     alignment and structure
>pdb|3QU5|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp11asn Mutant Length = 243 Back     alignment and structure
>pdb|3QU4|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13ala Mutant Length = 243 Back     alignment and structure
>pdb|3QUT|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Asp13asn Mutant, An Open Cap Conformation Length = 243 Back     alignment and structure
>pdb|3QUQ|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, An Open Cap Conformation Length = 243 Back     alignment and structure
>pdb|3R9K|A Chain A, Crystal Structure Of Pyrophosphatase From Bacteroides Thetaiotaomicron, Glu47asp Mutant Complexed With Sulfate, A Closed Cap Conformation Length = 243 Back     alignment and structure
>pdb|3D6J|A Chain A, Crystal Structure Of Putative Haloacid Dehalogenase-Like Hydrolase From Bacteroides Fragilis Length = 225 Back     alignment and structure
>pdb|4G9B|A Chain A, Crystal Structure Of Beta-Phosphoglucomutase Homolog From Escherichia Coli, Target Efi-501172, With Bound Mg, Open Lid Length = 243 Back     alignment and structure
>pdb|2FDR|A Chain A, Crystal Structure Of Conserved Haloacid Dehalogenase-like Protein Of Unknown Function Atu0790 From Agrobacterium Tumefaciens Str. C58 Length = 229 Back     alignment and structure
>pdb|3BNW|A Chain A, Crystal Structure Of Riboflavin Kinase From Trypanosoma Brucei Length = 181 Back     alignment and structure
>pdb|3KZX|A Chain A, Crystal Structure Of A Had-Superfamily Hydrolase From Ehrlichia Chaffeensis At 1.9a Resolution Length = 231 Back     alignment and structure
>pdb|2YY6|A Chain A, Crystal Structure Of The Phosphoglycolate Phosphatase From Aquifex Aeolicus Vf5 Length = 213 Back     alignment and structure
>pdb|2NYV|A Chain A, X-Ray Crystal Structure Of A Phosphoglycolate Phosphatase From Aquifex Aeolicus Length = 222 Back     alignment and structure
>pdb|3S6J|A Chain A, The Crystal Structure Of A Hydrolase From Pseudomonas Syringae Length = 233 Back     alignment and structure
>pdb|2HDO|A Chain A, Crystal Structure Of Putative Phosphoglycolate Phosphatase (Np_784602.1) From Lactobacillus Plantarum At 1.50 A Resolution Length = 209 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 8e-88
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 1e-67
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 3e-65
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 4e-63
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 2e-61
1te2_A226 Putative phosphatase; structural genomics, phospha 3e-60
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 2e-59
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 1e-55
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 9e-55
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 7e-53
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 1e-52
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 7e-52
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 2e-51
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 5e-36
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 2e-31
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 2e-31
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 3e-31
1n08_A163 Putative riboflavin kinase; phophoryl transferases 6e-31
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 1e-30
1nb0_A147 Hypothetical protein FLJ11149; beta barrel, transf 1e-30
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 4e-30
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 9e-30
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 5e-28
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 4e-27
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 8e-27
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 2e-26
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 3e-26
3bnw_A181 Riboflavin kinase, putative; APO structure, struct 3e-26
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 4e-25
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 8e-25
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 1e-24
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 3e-24
2zg6_A220 Putative uncharacterized protein ST2620, probable 6e-24
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 7e-24
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 9e-24
3sd7_A240 Putative phosphatase; structural genomics, haloaci 2e-23
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 3e-23
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 4e-23
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 7e-23
2hsz_A243 Novel predicted phosphatase; structural genomics, 9e-23
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 4e-22
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 4e-20
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 7e-20
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 1e-18
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 2e-18
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 7e-17
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 9e-17
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 1e-15
2p11_A231 Hypothetical protein; putative haloacid dehalogena 2e-15
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 5e-15
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 1e-14
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 5e-14
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 8e-14
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 9e-14
3ib6_A189 Uncharacterized protein; structural genomics, unkn 1e-12
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 2e-12
3op1_A308 Macrolide-efflux protein; structural genomics, PSI 2e-11
2x0k_A338 Riboflavin biosynthesis protein RIBF; riboflavin k 8e-11
1mrz_A293 Riboflavin kinase/FMN adenylyltransferase; rossman 1e-10
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 5e-09
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 9e-09
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 3e-07
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 3e-07
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 4e-07
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 1e-05
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 2e-05
2o2x_A218 Hypothetical protein; structural genomics, joint c 3e-05
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 6e-04
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 7e-04
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Length = 250 Back     alignment and structure
 Score =  262 bits (671), Expect = 8e-88
 Identities = 91/229 (39%), Positives = 129/229 (56%), Gaps = 5/229 (2%)

Query: 1   MAQPLKKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAA 60
           MA P + + + +I D+DG LL+T+ ++S V +    +Y K++    K  ++GK  LE A 
Sbjct: 23  MAAPPQPV-THLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQ 81

Query: 61  IIVEDYGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRAT 120
           II++   LP +K E V E  +   +       +PGA +LI HL  HG+P ALA++S  A+
Sbjct: 82  IIIDVLQLPMSKEELVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSRSAS 141

Query: 121 IESKISYQHGWNESFSVIVGSD--EVRTGKPSPDIFLEAAKRLNMEPSSS--LVIEDSVI 176
            + K S    +   FS IV  D  EV+ GKP PDIFL  AKR +  P+    LV ED+  
Sbjct: 142 FDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSPPPAMEKCLVFEDAPN 201

Query: 177 GVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPPFQ 225
           GV A  AAGM+VV VP         T A  V+NSL D +PE +GLP ++
Sbjct: 202 GVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPSYE 250


>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Length = 214 Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Length = 247 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Length = 243 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Length = 226 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Length = 259 Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Length = 221 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Length = 233 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Length = 229 Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Length = 233 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Length = 243 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Length = 275 Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} Length = 277 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Length = 267 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Length = 231 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Length = 190 Back     alignment and structure
>1n08_A Putative riboflavin kinase; phophoryl transferases, flavin cofactors, metal binding; HET: ADP; 1.60A {Schizosaccharomyces pombe} SCOP: b.43.5.1 PDB: 1n05_A* 1n07_A* 1n06_A* Length = 163 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 207 Back     alignment and structure
>1nb0_A Hypothetical protein FLJ11149; beta barrel, transferase; HET: ADP; 1.70A {Homo sapiens} SCOP: b.43.5.1 PDB: 1nb9_A* 1p4m_A* 1q9s_A* Length = 147 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 225 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Length = 209 Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Length = 234 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Length = 235 Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Length = 241 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} Length = 226 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Length = 205 Back     alignment and structure
>3bnw_A Riboflavin kinase, putative; APO structure, structural genomics, structural genomics of P protozoa consortium, SGPP, transferase; 2.40A {Trypanosoma brucei} Length = 181 Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Length = 200 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Length = 137 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Length = 263 Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Length = 206 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Length = 220 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Length = 222 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Length = 260 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Length = 240 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Length = 211 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Length = 238 Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Length = 210 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Length = 243 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Length = 240 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Length = 196 Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} PDB: 1x42_A Length = 234 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} Length = 240 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Length = 229 Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Length = 234 Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Length = 384 Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Length = 232 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Length = 231 Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Length = 240 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Length = 282 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Length = 251 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Length = 253 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Length = 261 Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Length = 189 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Length = 240 Back     alignment and structure
>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Length = 308 Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Length = 338 Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Length = 293 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Length = 201 Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Length = 187 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Length = 211 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Length = 179 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Length = 218 Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Length = 253 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Length = 264 Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 100.0
3op1_A308 Macrolide-efflux protein; structural genomics, PSI 100.0
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 99.98
2x0k_A338 Riboflavin biosynthesis protein RIBF; riboflavin k 99.98
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.97
1mrz_A293 Riboflavin kinase/FMN adenylyltransferase; rossman 99.97
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 99.97
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 99.97
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 99.97
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 99.97
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 99.96
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 99.96
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 99.96
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 99.96
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 99.96
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 99.96
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 99.96
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 99.96
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 99.96
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 99.96
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 99.96
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 99.96
3sd7_A240 Putative phosphatase; structural genomics, haloaci 99.95
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 99.95
2hsz_A243 Novel predicted phosphatase; structural genomics, 99.95
1te2_A226 Putative phosphatase; structural genomics, phospha 99.95
3bnw_A181 Riboflavin kinase, putative; APO structure, struct 99.95
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 99.95
1n08_A163 Putative riboflavin kinase; phophoryl transferases 99.95
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 99.95
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 99.95
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 99.95
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 99.94
1nb0_A147 Hypothetical protein FLJ11149; beta barrel, transf 99.94
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 99.94
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 99.94
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 99.94
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 99.94
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 99.94
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 99.94
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 99.94
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 99.93
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 99.93
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 99.93
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 99.93
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 99.93
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 99.93
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 99.93
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 99.93
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 99.93
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 99.93
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 99.93
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 99.93
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 99.92
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 99.92
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 99.92
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 99.92
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 99.91
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 99.91
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 99.91
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 99.91
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 99.91
2zg6_A220 Putative uncharacterized protein ST2620, probable 99.91
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 99.9
2p11_A231 Hypothetical protein; putative haloacid dehalogena 99.9
3ib6_A189 Uncharacterized protein; structural genomics, unkn 99.88
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.88
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 99.87
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 99.87
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 99.87
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.86
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.85
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 99.85
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 99.84
3fvv_A232 Uncharacterized protein; unknown function, structu 99.84
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 99.83
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.82
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.82
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.82
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 99.81
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.8
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.79
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.78
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 99.78
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 99.78
2o2x_A218 Hypothetical protein; structural genomics, joint c 99.77
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 99.77
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 99.77
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 99.76
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.76
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 99.75
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 99.74
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 99.74
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.74
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 99.73
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 99.73
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 99.72
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; 99.71
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 99.71
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 99.69
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 99.69
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 99.69
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.69
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 99.69
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 99.69
3mn1_A189 Probable YRBI family phosphatase; structural genom 99.68
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.68
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.68
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 99.66
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 99.65
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 99.65
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 99.63
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 99.43
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 99.61
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 99.59
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 99.58
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 99.57
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 99.56
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 99.54
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 99.53
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 99.52
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 99.49
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 99.49
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 99.49
3dao_A283 Putative phosphatse; structural genomics, joint ce 99.47
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 99.46
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 99.39
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 99.35
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.35
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 99.34
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 99.32
1l6r_A227 Hypothetical protein TA0175; structural genomics, 99.29
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitocho 99.21
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 99.19
1y8a_A332 Hypothetical protein AF1437; structural genomics, 99.18
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 99.14
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 99.12
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 99.06
2jc9_A555 Cytosolic purine 5'-nucleotidase; cytosolic 5-prim 99.05
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 99.02
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 99.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 98.94
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 98.94
4gxt_A385 A conserved functionally unknown protein; structur 98.81
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 98.8
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 98.53
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 98.52
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 98.44
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 98.43
4g63_A470 Cytosolic IMP-GMP specific 5'-nucleotidase; struct 98.41
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 98.35
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 98.22
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 97.99
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 97.85
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 97.78
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 97.76
3ar4_A 995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 97.73
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 97.54
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 97.54
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 97.54
2zxe_A 1028 Na, K-ATPase alpha subunit; membrane protein, ION 97.42
3ixz_A 1034 Potassium-transporting ATPase alpha; ION pump, H+, 97.18
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 97.13
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 97.12
1mhs_A 920 Proton pump, plasma membrane ATPase; ION transport 96.93
3b8c_A 885 ATPase 2, plasma membrane-type; P-type ATPase, pro 96.79
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 96.32
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 96.24
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 95.89
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 95.13
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 94.85
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 93.58
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 93.4
3geb_A274 EYES absent homolog 2; hydrolase, activator, alter 92.08
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 91.27
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 88.29
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 87.99
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 84.31
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 82.96
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 82.81
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 80.39
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.4e-31  Score=225.13  Aligned_cols=218  Identities=40%  Similarity=0.613  Sum_probs=193.5

Q ss_pred             ccCccEEEEecCCccccChHHHHHHHHHHHHHcCCCCChhhhhhhcCCCHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHh
Q 021360            6 KKLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLEEAAIIVEDYGLPCAKHEFVNEVYSMFSD   85 (313)
Q Consensus         6 ~~~~k~vifDlDGTL~d~~~~~~~~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   85 (313)
                      ++++|+|+||+||||+++...+..++.++++++|...+........|.........+++.++...+...+...+.+.+..
T Consensus        27 ~~~ik~i~fDlDGTL~d~~~~~~~~~~~~~~~~g~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  106 (250)
T 3l5k_A           27 PQPVTHLIFDMDGLLLDTERLYSVVFQEICNRYDKKYSWDVKSLVMGKKALEAAQIIIDVLQLPMSKEELVEESQTKLKE  106 (250)
T ss_dssp             CCCCSEEEEETBTTTBCHHHHHHHHHHHHHHHTTCCCCHHHHHHHTTCCHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHH
T ss_pred             ccCCcEEEEcCCCCcCCCHHHHHHHHHHHHHHhCCCCCHHHHHHhcCCCHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHH
Confidence            35789999999999999999999999999999999988888888889999998999999999888888887777777777


Q ss_pred             hhccCCCCchHHHHHHHHHHCCCCEEEEeCCchHHHHHHHHhhcCCccccceEEecC--CCCCCCCChHHHHHHHHHcCC
Q 021360           86 HLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSD--EVRTGKPSPDIFLEAAKRLNM  163 (313)
Q Consensus        86 ~~~~~~~~pgv~e~l~~l~~~g~~~~i~s~~~~~~~~~~l~~~~~~~~~f~~v~~~~--~~~~~kp~~~~~~~~~~~~~~  163 (313)
                      ......++|++.++|+.|++.|++++++||++...+...+.+..++..+|+.+++++  ++..+||+++.++.+++++|+
T Consensus       107 ~~~~~~~~~~~~~~l~~l~~~g~~~~i~sn~~~~~~~~~l~~~~~l~~~f~~~~~~~~~~~~~~Kp~~~~~~~~~~~lgi  186 (250)
T 3l5k_A          107 VFPTAALMPGAEKLIIHLRKHGIPFALATSSRSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGKPDPDIFLACAKRFSP  186 (250)
T ss_dssp             HGGGCCBCTTHHHHHHHHHHTTCCEEEECSCCHHHHHHHTTTCHHHHTTSSCEECTTCTTCCSCTTSTHHHHHHHHTSSS
T ss_pred             HhccCCCCCCHHHHHHHHHhCCCcEEEEeCCCHHHHHHHHHhccCHHhheeeEEecchhhccCCCCChHHHHHHHHHcCC
Confidence            777889999999999999999999999999998877776744568889999999999  888999999999999999999


Q ss_pred             CC--CcEEEEecCHhhHHHHHHcCCeEEEeCCCCCccccccccceeeccccccCccccCCCC
Q 021360          164 EP--SSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTHRYTAADEVINSLLDLRPEKWGLPP  223 (313)
Q Consensus       164 ~~--~~~i~vgD~~~Di~~a~~~G~~~i~v~~~~~~~~~~~~s~~ii~~l~e~~~~~~~~~~  223 (313)
                      ++  ++|++|||+.+|+.+|+.+|+.++++.++.........++.+++++.++.....++++
T Consensus       187 ~~~~~~~i~iGD~~~Di~~a~~aG~~~i~v~~~~~~~~~~~~ad~v~~sl~el~~~l~~l~~  248 (250)
T 3l5k_A          187 PPAMEKCLVFEDAPNGVEAALAAGMQVVMVPDGNLSRDLTTKATLVLNSLQDFQPELFGLPS  248 (250)
T ss_dssp             CCCGGGEEEEESSHHHHHHHHHTTCEEEECCCTTSCGGGSTTSSEECSCGGGCCGGGGTCCC
T ss_pred             CCCcceEEEEeCCHHHHHHHHHcCCEEEEEcCCCCchhhcccccEeecCHHHhhHHHhcCCC
Confidence            98  9999999999999999999999999998765555566899999999998766655443



>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-BIND multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3bnw_A Riboflavin kinase, putative; APO structure, structural genomics, structural genomics of P protozoa consortium, SGPP, transferase; 2.40A {Trypanosoma brucei} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>1n08_A Putative riboflavin kinase; phophoryl transferases, flavin cofactors, metal binding; HET: ADP; 1.60A {Schizosaccharomyces pombe} SCOP: b.43.5.1 PDB: 1n05_A* 1n07_A* 1n06_A* Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>1nb0_A Hypothetical protein FLJ11149; beta barrel, transferase; HET: ADP; 1.70A {Homo sapiens} SCOP: b.43.5.1 PDB: 1nb9_A* 1p4m_A* 1q9s_A* Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2jc9_A Cytosolic purine 5'-nucleotidase; cytosolic 5-prime nucleotidase II, GMP-IMP specific nucleotidase, CN-II, NT5C2, hydrolase, polymorphism; HET: ADN; 1.5A {Homo sapiens} PDB: 2j2c_A* 2xje_A* 2xjf_A* 2jcm_A* 2xcw_A* 2xcv_A* 2xcx_A 2xjb_A* 2xjc_A* 2xjd_A* Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>4g63_A Cytosolic IMP-GMP specific 5'-nucleotidase; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.70A {Legionella pneumophila subsp} PDB: 2bde_A Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3geb_A EYES absent homolog 2; hydrolase, activator, alternative splicing, cytoplasm, developmental protein, magnesium, nucleus, polymorphism; 2.40A {Homo sapiens} PDB: 3hb0_A 3hb1_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 313
d2b0ca1197 c.108.1.2 (A:8-204) Putative phosphatase YihX {Esc 2e-20
d1te2a_218 c.108.1.6 (A:) Phosphatase YniC {Escherichia coli 1e-19
d1zs9a1253 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapien 2e-19
d1cr6a1222 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal 5e-19
d2fdra1222 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 { 1e-18
d1o08a_221 c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcu 7e-18
d1zd3a1225 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal 1e-17
d1n08a_154 b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Sc 1e-16
d1swva_257 c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Ba 1e-16
d2fi1a1187 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Str 2e-16
d1nb9a_147 b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapie 7e-16
d1zrna_220 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pse 1e-15
d2g80a1225 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast 2e-15
d2go7a1204 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {S 8e-15
d2hdoa1207 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase { 1e-14
d1qq5a_245 c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xan 2e-14
d1qyia_380 c.108.1.13 (A:) Hypothetical protein MW1667 (SA154 2e-14
d2hsza1224 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase G 7e-14
d2hcfa1228 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {C 1e-13
d1u7pa_164 c.108.1.17 (A:) Magnesium-dependent phosphatase-1, 1e-13
d2feaa1226 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthio 4e-13
d2ah5a1210 c.108.1.6 (A:1-210) predicted phosphatase SP0104 { 3e-10
d2gfha1247 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatas 5e-10
d1x42a1230 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {A 1e-09
d1mrza1130 b.43.5.1 (A:159-288) Riboflavin kinase domain of b 1e-08
d1j97a_210 c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon 5e-06
d2fpwa1161 c.108.1.19 (A:3-163) Histidine biosynthesis bifunc 2e-05
d1nnla_217 c.108.1.4 (A:) Phosphoserine phosphatase {Human (H 2e-04
d1yv9a1253 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {En 0.001
d2o2xa1209 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 0.001
d2c4na1250 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId 0.001
d1wvia_253 c.108.1.14 (A:) Putative phosphatase SMU.1415c {St 0.003
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Length = 197 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: YihX-like
domain: Putative phosphatase YihX
species: Escherichia coli [TaxId: 562]
 Score = 85.2 bits (209), Expect = 2e-20
 Identities = 27/188 (14%), Positives = 59/188 (31%), Gaps = 10/188 (5%)

Query: 12  VILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGREKHKIVGKTPLE------EAAIIVED 65
            I DL   +++ D  F+ VL  +           +K   +G+   +            E 
Sbjct: 3   YIFDLGNVIVDID--FNRVLGAWSDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEA 60

Query: 66  YGLPCAKHEFVNEVYSMFSDHLCKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKI 125
                A      +    +      ++  P    ++  L   G  + + SN++R       
Sbjct: 61  LCHEMALPLSYEQFSHGWQAVFVALR--PEVIAIMHKLREQGHRVVVLSNTNRLHTTFWP 118

Query: 126 SYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNMEPSSSLVIEDSVIGVVAGKAAG 185
                  ++   I  S ++   KP   I+    +     PS ++  +D+   +      G
Sbjct: 119 EEYPEIRDAADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLG 178

Query: 186 MEVVAVPS 193
           +  + V  
Sbjct: 179 ITSILVKD 186


>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Length = 218 Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Length = 253 Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 222 Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Length = 222 Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Length = 221 Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1n08a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 154 Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Length = 257 Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Length = 187 Back     information, alignment and structure
>d1nb9a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Length = 220 Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 225 Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Length = 204 Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Length = 207 Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Length = 245 Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Length = 380 Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Length = 224 Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Length = 228 Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Length = 226 Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Length = 210 Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Length = 247 Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 230 Back     information, alignment and structure
>d1mrza1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Length = 130 Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 210 Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Length = 253 Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Length = 209 Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 99.97
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 99.97
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 99.96
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 99.96
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 99.95
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 99.95
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 99.95
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 99.95
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 99.95
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 99.94
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 99.93
d1n08a_154 Riboflavin kinase {Fission yeast (Schizosaccharomy 99.93
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 99.93
d1nb9a_147 Riboflavin kinase {Human (Homo sapiens) [TaxId: 96 99.92
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 99.92
d1mrza1130 Riboflavin kinase domain of bifunctional FAD synth 99.92
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 99.91
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 99.9
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 99.86
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 99.86
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 99.86
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 99.84
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 99.84
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 99.77
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.76
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 99.74
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.73
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 99.72
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 99.7
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.69
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 99.66
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 99.62
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 99.59
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 99.56
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 99.46
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.43
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 99.28
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 99.19
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 99.17
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 99.08
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 99.06
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.97
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 98.93
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 98.92
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 98.89
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.85
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.79
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 98.68
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 98.62
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 98.61
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 98.57
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.49
d2bdea1458 Cytosolic IMP-GMP specific 5'-nucleotidase {Legion 98.44
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.14
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 97.99
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 97.99
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.7
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.58
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.02
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 96.45
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 95.37
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 95.34
d1mrza2157 FMN adenylyltransferase domain of bifunctional FAD 92.52
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 91.09
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 89.82
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: beta-Phosphoglucomutase-like
domain: Phosphatase YniC
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=4.5e-30  Score=210.95  Aligned_cols=208  Identities=23%  Similarity=0.378  Sum_probs=171.5

Q ss_pred             cCccEEEEecCCccccChHHHHHHHHHHHHHcCCCCChh-hhhhhcCCCHHHHHHHHHHHhCCC-CCHHHHHHHHHHHHH
Q 021360            7 KLMSCVILDLDGTLLNTDGMFSEVLKTFLVKYGKEWDGR-EKHKIVGKTPLEEAAIIVEDYGLP-CAKHEFVNEVYSMFS   84 (313)
Q Consensus         7 ~~~k~vifDlDGTL~d~~~~~~~~~~~~~~~~g~~~~~~-~~~~~~g~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~   84 (313)
                      +++|+++||+||||+|+.+.+..++.++++++|.+++.. ......+................. .....+.....+.+.
T Consensus         1 ~~i~a~iFD~DGTL~dt~~~~~~a~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (218)
T d1te2a_           1 RQILAAIFDMDGLLIDSEPLWDRAELDVMASLGVDISRRNELPDTLGLRIDMVVDLWYARQPWNGPSRQEVVERVIARAI   80 (218)
T ss_dssp             CCCCEEEECCBTTTBCCHHHHHHHHHHHHHHTTCCGGGGGGSCCCTTCCHHHHHHHHHHHSCCSSSCHHHHHHHHHHHHH
T ss_pred             CcceEEEECCCCcccCCHHHHHHHHHHHHHHcCCCCCHHHHHHHHhCCCccchhhhhhhcccccchhHHHHHHHHHHHHH
Confidence            368999999999999999999999999999999887654 445566666666666555555443 334445454444444


Q ss_pred             hhh-ccCCCCchHHHHHHHHHHCCCCEEEEeCCchHHHHHHHHhhcCCccccceEEecCCCCCCCCChHHHHHHHHHcCC
Q 021360           85 DHL-CKVKALPGANRLIKHLSCHGVPMALASNSHRATIESKISYQHGWNESFSVIVGSDEVRTGKPSPDIFLEAAKRLNM  163 (313)
Q Consensus        85 ~~~-~~~~~~pgv~e~l~~l~~~g~~~~i~s~~~~~~~~~~l~~~~~~~~~f~~v~~~~~~~~~kp~~~~~~~~~~~~~~  163 (313)
                      ... ...+++||+.++|+.|++.|++++++||++...+...+ +++|+.++|+.++++++++.+||+|+.|+.+++++|+
T Consensus        81 ~~~~~~~~~~pg~~~~l~~L~~~g~~~~i~T~~~~~~~~~~l-~~~~l~~~F~~i~~~~~~~~~Kp~~~~~~~~~~~l~~  159 (218)
T d1te2a_          81 SLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHMLEKVL-TMFDLRDSFDALASAEKLPYSKPHPQVYLDCAAKLGV  159 (218)
T ss_dssp             HHHHHHCCBCTTHHHHHHHHHHTTCEEEEEESSCHHHHHHHH-HHTTCGGGCSEEEECTTSSCCTTSTHHHHHHHHHHTS
T ss_pred             HhhhccccccchHHHHHHHhhhcccccccccccccccccccc-ccccccccccccccccccccchhhHHHHHHHHHHcCC
Confidence            433 35678999999999999999999999999999998888 8899999999999999999999999999999999999


Q ss_pred             CCCcEEEEecCHhhHHHHHHcCCeEEEeCCCCCccc-cccccceeeccccccC
Q 021360          164 EPSSSLVIEDSVIGVVAGKAAGMEVVAVPSLPKQTH-RYTAADEVINSLLDLR  215 (313)
Q Consensus       164 ~~~~~i~vgD~~~Di~~a~~~G~~~i~v~~~~~~~~-~~~~s~~ii~~l~e~~  215 (313)
                      +|++|++|||+.+|+.+|+++|+.+++++....... ....++.+++++.|+.
T Consensus       160 ~~~~~l~igD~~~di~aA~~~G~~~i~v~~~~~~~~~~~~~a~~~i~~l~el~  212 (218)
T d1te2a_         160 DPLTCVALEDSVNGMIASKAARMRSIVVPAPEAQNDPRFVLANVKLSSLTELT  212 (218)
T ss_dssp             CGGGEEEEESSHHHHHHHHHTTCEEEECCCTTTTTCGGGGGSSEECSCGGGCC
T ss_pred             CchhcEEEeeCHHHHHHHHHcCCEEEEECCCCCccchhhcCCCEEECChhhCC
Confidence            999999999999999999999999999977433222 2457899999998874



>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n08a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nb9a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1mrza1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2bdea1 c.108.1.23 (A:2-459) Cytosolic IMP-GMP specific 5'-nucleotidase {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure