Citrus Sinensis ID: 021372
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| 145910320 | 535 | chloroplast biotin carboxylase [Gossypiu | 0.945 | 0.553 | 0.857 | 1e-146 | |
| 307566892 | 536 | acetyl-CoA carboxylase BC subunit [Jatro | 0.948 | 0.554 | 0.840 | 1e-145 | |
| 380853844 | 536 | acetyl-CoA carboxylase [Nicotiana tabacu | 0.945 | 0.552 | 0.846 | 1e-145 | |
| 238837063 | 536 | heteromeric acetyl-CoA biotin carboxylas | 0.948 | 0.554 | 0.833 | 1e-145 | |
| 224087339 | 528 | predicted protein [Populus trichocarpa] | 0.942 | 0.558 | 0.853 | 1e-144 | |
| 239759398 | 533 | biotin carboxylase [Camellia oleifera] | 0.942 | 0.553 | 0.848 | 1e-144 | |
| 224118754 | 526 | predicted protein [Populus trichocarpa] | 0.942 | 0.560 | 0.851 | 1e-144 | |
| 870726 | 536 | biotin carboxylase subunit [Nicotiana ta | 0.945 | 0.552 | 0.846 | 1e-144 | |
| 297736021 | 587 | unnamed protein product [Vitis vinifera] | 0.942 | 0.502 | 0.848 | 1e-144 | |
| 255557562 | 541 | Biotin caboxylase subunit (BC) of Het-AC | 0.958 | 0.554 | 0.834 | 1e-144 |
| >gi|145910320|gb|ABP98813.1| chloroplast biotin carboxylase [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
Score = 525 bits (1352), Expect = e-146, Method: Compositional matrix adjust.
Identities = 259/302 (85%), Positives = 275/302 (91%), Gaps = 6/302 (1%)
Query: 1 MDASMTMSKSVTTTSPGLFVGRGKGILRSSQCSFMVGSRTVNFPRQVVAGVGGKLKR-RC 59
MDAS+TM KSVT+ PGLF+GR + ++RSSQC+FMVGSR +N PRQ + K RC
Sbjct: 3 MDASLTMCKSVTS-PPGLFLGRSR-VIRSSQCTFMVGSR-INLPRQKAQSTQVRCKSSRC 59
Query: 60 GGGGALKVTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVC 119
GG AL CR EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVC
Sbjct: 60 GG--ALGAKCRAEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVC 117
Query: 120 IGEAPSSQSYLLIPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSI 179
IGEAPSSQSYLLIPNVLSAAISR CTMLHPGYGFL+ENAVFVEMCR+H INFIGPNPDSI
Sbjct: 118 IGEAPSSQSYLLIPNVLSAAISRNCTMLHPGYGFLSENAVFVEMCRDHRINFIGPNPDSI 177
Query: 180 RIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRL 239
R+MGDKSTARETMKNAGVPTVPGSDGLLQSTEEA+KLA E+GFPVMIKATAGGGGRGMRL
Sbjct: 178 RVMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAIKLAHEIGFPVMIKATAGGGGRGMRL 237
Query: 240 AKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCS 299
+KEPDEFVKLLQQAKSEAAAAFGNDGVYLEKY+QNPRHIEFQ LADKYGNVVHFGERDCS
Sbjct: 238 SKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYIQNPRHIEFQALADKYGNVVHFGERDCS 297
Query: 300 IQ 301
IQ
Sbjct: 298 IQ 299
|
Source: Gossypium hirsutum Species: Gossypium hirsutum Genus: Gossypium Family: Malvaceae Order: Malvales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|307566892|gb|ADN52612.1| acetyl-CoA carboxylase BC subunit [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|380853844|gb|AFE88229.1| acetyl-CoA carboxylase [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|238837063|gb|ACR61637.1| heteromeric acetyl-CoA biotin carboxylase [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|224087339|ref|XP_002308127.1| predicted protein [Populus trichocarpa] gi|290463112|sp|B9HBA8.1|ACCC1_POPTR RecName: Full=Biotin carboxylase 1, chloroplastic; AltName: Full=Acetyl-CoA carboxylase subunit A 1; Short=ACC; Flags: Precursor gi|222854103|gb|EEE91650.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|239759398|gb|ACS14663.1| biotin carboxylase [Camellia oleifera] | Back alignment and taxonomy information |
|---|
| >gi|224118754|ref|XP_002331438.1| predicted protein [Populus trichocarpa] gi|290463113|sp|B9N843.1|ACCC2_POPTR RecName: Full=Biotin carboxylase 2, chloroplastic; AltName: Full=Acetyl-CoA carboxylase subunit A 2; Short=ACC; Flags: Precursor gi|222873652|gb|EEF10783.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|870726|gb|AAC41659.1| biotin carboxylase subunit [Nicotiana tabacum] gi|1582354|prf||2118337A Ac-CoA carboxylase:SUBUNIT=biotin carboxylase | Back alignment and taxonomy information |
|---|
| >gi|297736021|emb|CBI24059.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255557562|ref|XP_002519811.1| Biotin caboxylase subunit (BC) of Het-ACCase [Ricinus communis] gi|223541050|gb|EEF42607.1| Biotin caboxylase subunit (BC) of Het-ACCase [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| TIGR_CMR|BA_4408 | 450 | BA_4408 "acetyl-CoA carboxylas | 0.734 | 0.511 | 0.578 | 1.1e-73 | |
| TIGR_CMR|SPO_1010 | 449 | SPO_1010 "acetyl-CoA carboxyla | 0.734 | 0.512 | 0.595 | 1.2e-72 | |
| TIGR_CMR|CHY_1998 | 449 | CHY_1998 "acetyl-CoA carboxyla | 0.734 | 0.512 | 0.604 | 2e-72 | |
| TIGR_CMR|GSU_2019 | 446 | GSU_2019 "acetyl-CoA carboxyla | 0.731 | 0.513 | 0.589 | 5.5e-70 | |
| TIGR_CMR|CJE_1482 | 443 | CJE_1482 "acetyl-CoA carboxyla | 0.734 | 0.519 | 0.547 | 1.5e-67 | |
| TIGR_CMR|CHY_0918 | 517 | CHY_0918 "acetyl-CoA carboxyla | 0.728 | 0.441 | 0.549 | 2.4e-67 | |
| UNIPROTKB|Q9KV62 | 447 | VC_0295 "Acetyl-CoA carboxylas | 0.734 | 0.514 | 0.545 | 1.2e-65 | |
| TIGR_CMR|VC_0295 | 447 | VC_0295 "acetyl-CoA carboxylas | 0.734 | 0.514 | 0.545 | 1.2e-65 | |
| UNIPROTKB|P24182 | 449 | accC [Escherichia coli K-12 (t | 0.734 | 0.512 | 0.541 | 3.7e-64 | |
| UNIPROTKB|Q487S0 | 448 | accC "Acetyl-CoA carboxylase, | 0.734 | 0.513 | 0.536 | 3.7e-64 |
| TIGR_CMR|BA_4408 BA_4408 "acetyl-CoA carboxylase, biotin carboxylase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Score = 744 (267.0 bits), Expect = 1.1e-73, P = 1.1e-73
Identities = 133/230 (57%), Positives = 182/230 (79%)
Query: 72 EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLL 131
+K+L+ANRGEIAVR+IR EM I VA+YS DK++LHV++ADE+ C+G S +SYL
Sbjct: 3 KKVLIANRGEIAVRIIRACKEMDIETVAIYSEADKESLHVQIADEAYCVGPTISKESYLN 62
Query: 132 IPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARET 191
+ N++S A GC +HPGYGFLAENA F E+CRE + FIGP+P++I MG K AR+T
Sbjct: 63 LTNIISVAKLTGCDAIHPGYGFLAENADFAELCRECNLIFIGPSPEAISKMGTKDVARDT 122
Query: 192 MKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQ 251
MK AGVP VPGS G++++TEEA++LA+++G+PV+IKATAGGGG+G+R+A+ +E VK +Q
Sbjct: 123 MKEAGVPIVPGSQGIIKNTEEAIELANQIGYPVIIKATAGGGGKGIRVARHEEELVKGIQ 182
Query: 252 QAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQ 301
+ EA+ AFGN GVYLEKYV++ RH+E Q++AD +GN +H GERDC+IQ
Sbjct: 183 ITQQEASTAFGNPGVYLEKYVEDFRHVEIQIMADTHGNAIHLGERDCTIQ 232
|
|
| TIGR_CMR|SPO_1010 SPO_1010 "acetyl-CoA carboxylase, biotin carboxylase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1998 CHY_1998 "acetyl-CoA carboxylase, biotin carboxylase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_2019 GSU_2019 "acetyl-CoA carboxylase, biotin carboxylase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_1482 CJE_1482 "acetyl-CoA carboxylase, biotin carboxylase" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0918 CHY_0918 "acetyl-CoA carboxylase, biotin carboxylase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KV62 VC_0295 "Acetyl-CoA carboxylase, biotin carboxylase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0295 VC_0295 "acetyl-CoA carboxylase, biotin carboxylase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P24182 accC [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q487S0 accC "Acetyl-CoA carboxylase, biotin carboxylase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_VI0248 | hypothetical protein (528 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| eugene3.00041116 | • | • | • | • | 0.976 | ||||||
| estExt_Genewise1_v1.C_LG_XVII1359 | • | • | • | • | 0.974 | ||||||
| grail3.0095003402 | • | • | • | • | 0.974 | ||||||
| estExt_fgenesh4_pg.C_LG_IX0832 | • | • | • | 0.963 | |||||||
| gw1.XIV.1152.1 | • | • | • | • | 0.958 | ||||||
| eugene3.00161050 | • | • | • | • | 0.939 | ||||||
| eugene3.00060828 | • | • | • | • | 0.939 | ||||||
| fgenesh4_pg.C_scaffold_16349000001 | • | • | • | • | • | • | 0.921 | ||||
| fgenesh4_pg.C_LG_XV000664 | • | • | • | 0.919 | |||||||
| eugene3.00140876 | • | • | 0.911 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| PRK08591 | 451 | PRK08591, PRK08591, acetyl-CoA carboxylase biotin | 1e-160 | |
| TIGR00514 | 449 | TIGR00514, accC, acetyl-CoA carboxylase, biotin ca | 1e-152 | |
| COG4770 | 645 | COG4770, COG4770, Acetyl/propionyl-CoA carboxylase | 1e-124 | |
| PRK05586 | 447 | PRK05586, PRK05586, biotin carboxylase; Validated | 1e-123 | |
| COG0439 | 449 | COG0439, AccC, Biotin carboxylase [Lipid metabolis | 1e-122 | |
| PRK08654 | 499 | PRK08654, PRK08654, pyruvate carboxylase subunit A | 1e-118 | |
| PRK08462 | 445 | PRK08462, PRK08462, biotin carboxylase; Validated | 1e-114 | |
| PRK12999 | 1146 | PRK12999, PRK12999, pyruvate carboxylase; Reviewed | 1e-113 | |
| PRK06111 | 450 | PRK06111, PRK06111, acetyl-CoA carboxylase biotin | 1e-110 | |
| PRK07178 | 472 | PRK07178, PRK07178, pyruvate carboxylase subunit A | 1e-104 | |
| COG1038 | 1149 | COG1038, PycA, Pyruvate carboxylase [Energy produc | 1e-100 | |
| TIGR02712 | 1201 | TIGR02712, urea_carbox, urea carboxylase | 1e-97 | |
| PRK12833 | 467 | PRK12833, PRK12833, acetyl-CoA carboxylase biotin | 2e-97 | |
| TIGR01235 | 1143 | TIGR01235, pyruv_carbox, pyruvate carboxylase | 2e-89 | |
| PRK08463 | 478 | PRK08463, PRK08463, acetyl-CoA carboxylase subunit | 2e-87 | |
| pfam02786 | 211 | pfam02786, CPSase_L_D2, Carbamoyl-phosphate syntha | 8e-53 | |
| pfam00289 | 108 | pfam00289, CPSase_L_chain, Carbamoyl-phosphate syn | 9e-50 | |
| COG0458 | 400 | COG0458, CarB, Carbamoylphosphate synthase large s | 7e-14 | |
| PRK05294 | 1066 | PRK05294, carB, carbamoyl phosphate synthase large | 3e-12 | |
| TIGR01369 | 1050 | TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth | 1e-11 | |
| PRK12815 | 1068 | PRK12815, carB, carbamoyl phosphate synthase large | 3e-11 | |
| PRK12815 | 1068 | PRK12815, carB, carbamoyl phosphate synthase large | 5e-11 | |
| COG0026 | 375 | COG0026, PurK, Phosphoribosylaminoimidazole carbox | 7e-11 | |
| TIGR01369 | 1050 | TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synth | 2e-10 | |
| TIGR01161 | 352 | TIGR01161, purK, phosphoribosylaminoimidazole carb | 2e-10 | |
| PLN02735 | 1102 | PLN02735, PLN02735, carbamoyl-phosphate synthase | 6e-10 | |
| PRK06019 | 372 | PRK06019, PRK06019, phosphoribosylaminoimidazole c | 3e-09 | |
| TIGR00877 | 422 | TIGR00877, purD, phosphoribosylamine--glycine liga | 2e-08 | |
| pfam13535 | 183 | pfam13535, ATP-grasp_4, ATP-grasp domain | 4e-08 | |
| PLN02735 | 1102 | PLN02735, PLN02735, carbamoyl-phosphate synthase | 2e-07 | |
| COG0151 | 428 | COG0151, PurD, Phosphoribosylamine-glycine ligase | 4e-07 | |
| TIGR00768 | 277 | TIGR00768, rimK_fam, alpha-L-glutamate ligases, Ri | 4e-07 | |
| TIGR02144 | 280 | TIGR02144, LysX_arch, Lysine biosynthesis enzyme L | 6e-07 | |
| TIGR02068 | 864 | TIGR02068, cya_phycin_syn, cyanophycin synthetase | 8e-07 | |
| PRK01372 | 304 | PRK01372, ddl, D-alanine--D-alanine ligase; Review | 1e-06 | |
| PRK05294 | 1066 | PRK05294, carB, carbamoyl phosphate synthase large | 2e-06 | |
| PLN02948 | 577 | PLN02948, PLN02948, phosphoribosylaminoimidazole c | 2e-06 | |
| PRK13790 | 379 | PRK13790, PRK13790, phosphoribosylamine--glycine l | 2e-05 | |
| pfam02222 | 171 | pfam02222, ATP-grasp, ATP-grasp domain | 2e-05 | |
| PRK12767 | 326 | PRK12767, PRK12767, carbamoyl phosphate synthase-l | 3e-05 | |
| pfam08442 | 202 | pfam08442, ATP-grasp_2, ATP-grasp domain | 4e-05 | |
| TIGR01205 | 315 | TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine l | 5e-05 | |
| PRK00885 | 420 | PRK00885, PRK00885, phosphoribosylamine--glycine l | 5e-05 | |
| PRK00696 | 388 | PRK00696, sucC, succinyl-CoA synthetase subunit be | 5e-05 | |
| pfam01071 | 193 | pfam01071, GARS_A, Phosphoribosylglycinamide synth | 6e-05 | |
| COG0189 | 318 | COG0189, RimK, Glutathione synthase/Ribosomal prot | 8e-05 | |
| COG0045 | 387 | COG0045, SucC, Succinyl-CoA synthetase, beta subun | 9e-05 | |
| PRK02186 | 887 | PRK02186, PRK02186, argininosuccinate lyase; Provi | 1e-04 | |
| PRK14016 | 727 | PRK14016, PRK14016, cyanophycin synthetase; Provis | 1e-04 | |
| PRK13789 | 426 | PRK13789, PRK13789, phosphoribosylamine--glycine l | 2e-04 | |
| COG1181 | 317 | COG1181, DdlA, D-alanine-D-alanine ligase and rela | 5e-04 | |
| TIGR01142 | 380 | TIGR01142, purT, phosphoribosylglycinamide formylt | 6e-04 | |
| pfam08443 | 190 | pfam08443, RimK, RimK-like ATP-grasp domain | 7e-04 | |
| TIGR01016 | 386 | TIGR01016, sucCoAbeta, succinyl-CoA synthetase, be | 8e-04 |
| >gnl|CDD|236307 PRK08591, PRK08591, acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
Score = 454 bits (1170), Expect = e-160
Identities = 144/230 (62%), Positives = 181/230 (78%)
Query: 72 EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLL 131
+KIL+ANRGEIA+R+IR E+GI VAV+ST D+DALHV+LADE+VCIG APS +SYL
Sbjct: 3 DKILIANRGEIALRIIRACKELGIKTVAVHSTADRDALHVQLADEAVCIGPAPSKKSYLN 62
Query: 132 IPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARET 191
IP ++SAA G +HPGYGFL+ENA F E+C + G FIGP+ ++IR+MGDK TA+ T
Sbjct: 63 IPAIISAAEITGADAIHPGYGFLSENADFAEICEDSGFTFIGPSAETIRLMGDKVTAKAT 122
Query: 192 MKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQ 251
MK AGVP VPGSDG + EEA+ +A E+G+PV+IKATAGGGGRGMR+ + E K
Sbjct: 123 MKKAGVPVVPGSDGPVDDEEEALAIAKEIGYPVIIKATAGGGGRGMRVVRTEAELEKAFS 182
Query: 252 QAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQ 301
A++EA AAFGN GVY+EKY++NPRHIE QVLAD +GN +H GERDCS+Q
Sbjct: 183 MARAEAKAAFGNPGVYMEKYLENPRHIEIQVLADGHGNAIHLGERDCSLQ 232
|
Length = 451 |
| >gnl|CDD|129605 TIGR00514, accC, acetyl-CoA carboxylase, biotin carboxylase subunit | Back alignment and domain information |
|---|
| >gnl|CDD|227111 COG4770, COG4770, Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|180150 PRK05586, PRK05586, biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223516 COG0439, AccC, Biotin carboxylase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236325 PRK08654, PRK08654, pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236269 PRK08462, PRK08462, biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237263 PRK12999, PRK12999, pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180406 PRK06111, PRK06111, acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180865 PRK07178, PRK07178, pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223968 COG1038, PycA, Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233980 TIGR02712, urea_carbox, urea carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|183781 PRK12833, PRK12833, acetyl-CoA carboxylase biotin carboxylase subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130302 TIGR01235, pyruv_carbox, pyruvate carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|169452 PRK08463, PRK08463, acetyl-CoA carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|190425 pfam02786, CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|201133 pfam00289, CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|223534 COG0458, CarB, Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237215 PRK12815, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223105 COG0026, PurK, Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233379 TIGR01369, CPSaseII_lrg, carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233295 TIGR01161, purK, phosphoribosylaminoimidazole carboxylase, PurK protein | Back alignment and domain information |
|---|
| >gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|235674 PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233164 TIGR00877, purD, phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >gnl|CDD|222206 pfam13535, ATP-grasp_4, ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|215391 PLN02735, PLN02735, carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223229 COG0151, PurD, Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233121 TIGR00768, rimK_fam, alpha-L-glutamate ligases, RimK family | Back alignment and domain information |
|---|
| >gnl|CDD|131199 TIGR02144, LysX_arch, Lysine biosynthesis enzyme LysX | Back alignment and domain information |
|---|
| >gnl|CDD|233705 TIGR02068, cya_phycin_syn, cyanophycin synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|234948 PRK01372, ddl, D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235393 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178534 PLN02948, PLN02948, phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|237507 PRK13790, PRK13790, phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216935 pfam02222, ATP-grasp, ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|237195 PRK12767, PRK12767, carbamoyl phosphate synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219843 pfam08442, ATP-grasp_2, ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|233310 TIGR01205, D_ala_D_alaTIGR, D-alanine--D-alanine ligase | Back alignment and domain information |
|---|
| >gnl|CDD|234856 PRK00885, PRK00885, phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234813 PRK00696, sucC, succinyl-CoA synthetase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216282 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain | Back alignment and domain information |
|---|
| >gnl|CDD|223267 COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223123 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235010 PRK02186, PRK02186, argininosuccinate lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237586 PRK14016, PRK14016, cyanophycin synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184327 PRK13789, PRK13789, phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224102 COG1181, DdlA, D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|130212 TIGR01142, purT, phosphoribosylglycinamide formyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|117020 pfam08443, RimK, RimK-like ATP-grasp domain | Back alignment and domain information |
|---|
| >gnl|CDD|233234 TIGR01016, sucCoAbeta, succinyl-CoA synthetase, beta subunit | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| COG4770 | 645 | Acetyl/propionyl-CoA carboxylase, alpha subunit [L | 100.0 | |
| KOG0238 | 670 | consensus 3-Methylcrotonyl-CoA carboxylase, biotin | 100.0 | |
| COG0439 | 449 | AccC Biotin carboxylase [Lipid metabolism] | 100.0 | |
| PRK08654 | 499 | pyruvate carboxylase subunit A; Validated | 100.0 | |
| COG1038 | 1149 | PycA Pyruvate carboxylase [Energy production and c | 100.0 | |
| PRK07178 | 472 | pyruvate carboxylase subunit A; Validated | 100.0 | |
| PRK12833 | 467 | acetyl-CoA carboxylase biotin carboxylase subunit; | 100.0 | |
| TIGR00514 | 449 | accC acetyl-CoA carboxylase, biotin carboxylase su | 100.0 | |
| PRK08462 | 445 | biotin carboxylase; Validated | 100.0 | |
| PRK08463 | 478 | acetyl-CoA carboxylase subunit A; Validated | 100.0 | |
| PRK05586 | 447 | biotin carboxylase; Validated | 100.0 | |
| PRK08591 | 451 | acetyl-CoA carboxylase biotin carboxylase subunit; | 100.0 | |
| KOG0369 | 1176 | consensus Pyruvate carboxylase [Energy production | 100.0 | |
| PRK12999 | 1146 | pyruvate carboxylase; Reviewed | 100.0 | |
| TIGR01235 | 1143 | pyruv_carbox pyruvate carboxylase. This enzyme pla | 100.0 | |
| TIGR02712 | 1201 | urea_carbox urea carboxylase. Members of this fami | 100.0 | |
| PRK06111 | 450 | acetyl-CoA carboxylase biotin carboxylase subunit; | 100.0 | |
| PLN02735 | 1102 | carbamoyl-phosphate synthase | 99.97 | |
| TIGR01369 | 1050 | CPSaseII_lrg carbamoyl-phosphate synthase, large s | 99.96 | |
| TIGR01142 | 380 | purT phosphoribosylglycinamide formyltransferase 2 | 99.96 | |
| PLN02735 | 1102 | carbamoyl-phosphate synthase | 99.96 | |
| PRK05294 | 1066 | carB carbamoyl phosphate synthase large subunit; R | 99.96 | |
| PRK12767 | 326 | carbamoyl phosphate synthase-like protein; Provisi | 99.96 | |
| PRK09288 | 395 | purT phosphoribosylglycinamide formyltransferase 2 | 99.96 | |
| PRK12815 | 1068 | carB carbamoyl phosphate synthase large subunit; R | 99.96 | |
| PRK06019 | 372 | phosphoribosylaminoimidazole carboxylase ATPase su | 99.96 | |
| KOG0368 | 2196 | consensus Acetyl-CoA carboxylase [Lipid transport | 99.96 | |
| TIGR01369 | 1050 | CPSaseII_lrg carbamoyl-phosphate synthase, large s | 99.95 | |
| TIGR01161 | 352 | purK phosphoribosylaminoimidazole carboxylase, Pur | 99.95 | |
| PRK07206 | 416 | hypothetical protein; Provisional | 99.95 | |
| PLN02948 | 577 | phosphoribosylaminoimidazole carboxylase | 99.95 | |
| PRK06395 | 435 | phosphoribosylamine--glycine ligase; Provisional | 99.95 | |
| TIGR00877 | 423 | purD phosphoribosylamine--glycine ligase. This enz | 99.95 | |
| PRK05294 | 1066 | carB carbamoyl phosphate synthase large subunit; R | 99.95 | |
| PRK06849 | 389 | hypothetical protein; Provisional | 99.95 | |
| PRK12815 | 1068 | carB carbamoyl phosphate synthase large subunit; R | 99.95 | |
| PRK13789 | 426 | phosphoribosylamine--glycine ligase; Provisional | 99.95 | |
| PRK00885 | 420 | phosphoribosylamine--glycine ligase; Provisional | 99.95 | |
| COG0458 | 400 | CarB Carbamoylphosphate synthase large subunit (sp | 99.94 | |
| PRK05784 | 486 | phosphoribosylamine--glycine ligase; Provisional | 99.93 | |
| PRK01372 | 304 | ddl D-alanine--D-alanine ligase; Reviewed | 99.93 | |
| PF15632 | 329 | ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa | 99.93 | |
| PLN02257 | 434 | phosphoribosylamine--glycine ligase | 99.93 | |
| PRK01966 | 333 | ddl D-alanyl-alanine synthetase A; Reviewed | 99.92 | |
| PRK14569 | 296 | D-alanyl-alanine synthetase A; Provisional | 99.92 | |
| PRK02186 | 887 | argininosuccinate lyase; Provisional | 99.92 | |
| COG0027 | 394 | PurT Formate-dependent phosphoribosylglycinamide f | 99.92 | |
| PRK14572 | 347 | D-alanyl-alanine synthetase A; Provisional | 99.92 | |
| PRK14568 | 343 | vanB D-alanine--D-lactate ligase; Provisional | 99.92 | |
| COG0026 | 375 | PurK Phosphoribosylaminoimidazole carboxylase (NCA | 99.92 | |
| PF02786 | 211 | CPSase_L_D2: Carbamoyl-phosphate synthase L chain, | 99.91 | |
| TIGR01205 | 315 | D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a | 99.91 | |
| PRK14570 | 364 | D-alanyl-alanine synthetase A; Provisional | 99.9 | |
| COG0151 | 428 | PurD Phosphoribosylamine-glycine ligase [Nucleotid | 99.89 | |
| PRK14571 | 299 | D-alanyl-alanine synthetase A; Provisional | 99.89 | |
| PRK13790 | 379 | phosphoribosylamine--glycine ligase; Provisional | 99.89 | |
| PRK14573 | 809 | bifunctional D-alanyl-alanine synthetase A/UDP-N-a | 99.87 | |
| PRK13278 | 358 | purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D | 99.86 | |
| PRK10446 | 300 | ribosomal protein S6 modification protein; Provisi | 99.84 | |
| PRK06524 | 493 | biotin carboxylase-like protein; Validated | 99.83 | |
| TIGR00768 | 277 | rimK_fam alpha-L-glutamate ligases, RimK family. T | 99.81 | |
| PF00289 | 110 | CPSase_L_chain: Carbamoyl-phosphate synthase L cha | 99.8 | |
| PRK13277 | 366 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo | 99.79 | |
| TIGR02144 | 280 | LysX_arch Lysine biosynthesis enzyme LysX. The fam | 99.78 | |
| PRK14016 | 727 | cyanophycin synthetase; Provisional | 99.78 | |
| TIGR03103 | 547 | trio_acet_GNAT GNAT-family acetyltransferase TIGR0 | 99.77 | |
| PF13535 | 184 | ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A | 99.74 | |
| KOG0237 | 788 | consensus Glycinamide ribonucleotide synthetase (G | 99.73 | |
| COG0189 | 318 | RimK Glutathione synthase/Ribosomal protein S6 mod | 99.71 | |
| KOG0370 | 1435 | consensus Multifunctional pyrimidine synthesis pro | 99.68 | |
| COG3919 | 415 | Predicted ATP-grasp enzyme [General function predi | 99.65 | |
| COG1181 | 317 | DdlA D-alanine-D-alanine ligase and related ATP-gr | 99.63 | |
| TIGR02068 | 864 | cya_phycin_syn cyanophycin synthetase. Cyanophycin | 99.61 | |
| PRK02471 | 752 | bifunctional glutamate--cysteine ligase/glutathion | 99.61 | |
| KOG0370 | 1435 | consensus Multifunctional pyrimidine synthesis pro | 99.59 | |
| TIGR01435 | 737 | glu_cys_lig_rel glutamate--cysteine ligase/gamma-g | 99.56 | |
| PF07478 | 203 | Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In | 99.56 | |
| PRK12458 | 338 | glutathione synthetase; Provisional | 99.54 | |
| ), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071 | 194 | GARS_A: Phosphoribosylglycinamide synthetase, ATP- | 99.54 | |
| PF08443 | 190 | RimK: RimK-like ATP-grasp domain; InterPro: IPR013 | 99.52 | |
| PF02222 | 172 | ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T | 99.51 | |
| PLN02941 | 328 | inositol-tetrakisphosphate 1-kinase | 99.47 | |
| TIGR01380 | 312 | glut_syn glutathione synthetase, prokaryotic. This | 99.47 | |
| COG1759 | 361 | 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofu | 99.47 | |
| PRK05246 | 316 | glutathione synthetase; Provisional | 99.46 | |
| COG2232 | 389 | Predicted ATP-dependent carboligase related to bio | 99.4 | |
| PRK00696 | 388 | sucC succinyl-CoA synthetase subunit beta; Provisi | 99.31 | |
| PF02655 | 161 | ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 | 99.24 | |
| TIGR01016 | 386 | sucCoAbeta succinyl-CoA synthetase, beta subunit. | 99.23 | |
| PF13549 | 222 | ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A. | 99.21 | |
| TIGR02291 | 317 | rimK_rel_E_lig alpha-L-glutamate ligase-related pr | 98.92 | |
| COG1821 | 307 | Predicted ATP-utilizing enzyme (ATP-grasp superfam | 98.91 | |
| PRK14046 | 392 | malate--CoA ligase subunit beta; Provisional | 98.86 | |
| COG0045 | 387 | SucC Succinyl-CoA synthetase, beta subunit [Energy | 98.8 | |
| PF08442 | 202 | ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 | 98.71 | |
| PLN00124 | 422 | succinyl-CoA ligase [GDP-forming] subunit beta; Pr | 98.63 | |
| PF14397 | 285 | ATPgrasp_ST: Sugar-transfer associated ATP-grasp | 98.53 | |
| PLN02235 | 423 | ATP citrate (pro-S)-lyase | 98.41 | |
| PF02955 | 173 | GSH-S_ATP: Prokaryotic glutathione synthetase, ATP | 98.35 | |
| ), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF02844">PF02844 | 100 | GARS_N: Phosphoribosylglycinamide synthetase, N do | 98.24 | |
| PF14398 | 262 | ATPgrasp_YheCD: YheC/D like ATP-grasp | 98.11 | |
| PF06849 | 124 | DUF1246: Protein of unknown function (DUF1246); In | 98.06 | |
| PF05770 | 307 | Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- | 97.72 | |
| PF14403 | 445 | CP_ATPgrasp_2: Circularly permuted ATP-grasp type | 97.67 | |
| PF14305 | 239 | ATPgrasp_TupA: TupA-like ATPgrasp | 97.19 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 96.98 | |
| PF11379 | 355 | DUF3182: Protein of unknown function (DUF3182); In | 96.81 | |
| PRK08057 | 248 | cobalt-precorrin-6x reductase; Reviewed | 96.66 | |
| TIGR00715 | 256 | precor6x_red precorrin-6x reductase. This enzyme w | 96.59 | |
| COG2099 | 257 | CobK Precorrin-6x reductase [Coenzyme metabolism] | 96.48 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 96.44 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 96.4 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 96.38 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 96.21 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 96.17 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 96.14 | |
| PF03133 | 292 | TTL: Tubulin-tyrosine ligase family; InterPro: IPR | 96.05 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 96.05 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 95.96 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 95.84 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 95.79 | |
| PF02571 | 249 | CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: | 95.67 | |
| KOG2799 | 434 | consensus Succinyl-CoA synthetase, beta subunit [E | 95.56 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 95.52 | |
| KOG3895 | 488 | consensus Synaptic vesicle protein Synapsin [Signa | 95.5 | |
| PF01820 | 117 | Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; In | 95.47 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 95.46 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 95.44 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 95.41 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 95.28 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 95.17 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 95.15 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 95.15 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 95.13 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 95.08 | |
| KOG1447 | 412 | consensus GTP-specific succinyl-CoA synthetase, be | 95.02 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 94.95 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 94.94 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 94.89 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 94.61 | |
| PF02750 | 203 | Synapsin_C: Synapsin, ATP binding domain; InterPro | 94.55 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 94.45 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 94.43 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 94.37 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 94.35 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.3 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 94.23 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 94.22 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 94.2 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 94.16 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.15 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 94.12 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 94.05 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 94.05 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 94.04 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 94.04 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 94.02 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 93.99 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 93.98 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.94 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.94 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 93.9 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 93.9 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.88 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 93.87 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 93.78 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 93.77 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 93.73 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 93.69 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 93.68 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 93.67 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 93.63 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 93.6 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 93.57 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 93.5 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 93.5 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 93.47 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 93.47 | |
| PRK08643 | 256 | acetoin reductase; Validated | 93.44 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 93.44 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 93.43 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 93.4 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 93.39 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 93.37 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 93.35 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 93.33 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 93.32 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 93.29 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 93.27 | |
| PRK06988 | 312 | putative formyltransferase; Provisional | 93.26 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 93.22 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 93.22 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 93.2 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 93.18 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 93.17 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 93.17 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 93.17 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 93.14 | |
| PRK05472 | 213 | redox-sensing transcriptional repressor Rex; Provi | 93.1 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 93.1 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 93.09 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 93.06 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 93.02 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 92.97 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 92.97 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.94 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 92.94 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 92.89 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 92.88 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 92.85 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.85 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 92.76 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.75 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 92.73 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 92.69 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 92.68 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 92.67 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 92.66 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 92.58 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 92.57 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 92.54 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 92.52 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 92.5 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 92.45 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 92.44 | |
| TIGR03025 | 445 | EPS_sugtrans exopolysaccharide biosynthesis polypr | 92.44 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 92.43 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 92.43 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.42 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 92.42 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 92.41 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 92.41 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 92.35 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 92.33 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 92.3 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 92.29 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 92.28 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 92.27 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 92.26 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 92.23 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 92.23 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.17 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 92.15 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 92.15 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 92.12 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 92.09 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 92.07 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 92.07 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 92.06 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 92.05 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 92.03 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 92.03 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 91.99 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 91.99 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.93 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 91.92 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 91.92 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 91.89 | |
| KOG0023 | 360 | consensus Alcohol dehydrogenase, class V [Secondar | 91.88 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 91.85 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 91.85 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 91.82 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 91.8 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 91.79 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 91.78 | |
| COG1832 | 140 | Predicted CoA-binding protein [General function pr | 91.76 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 91.64 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 91.63 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.6 | |
| COG2308 | 488 | Uncharacterized conserved protein [Function unknow | 91.59 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 91.57 | |
| PRK10124 | 463 | putative UDP-glucose lipid carrier transferase; Pr | 91.56 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 91.55 | |
| COG0289 | 266 | DapB Dihydrodipicolinate reductase [Amino acid tra | 91.54 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.53 | |
| PRK05868 | 372 | hypothetical protein; Validated | 91.52 | |
| cd01485 | 198 | E1-1_like Ubiquitin activating enzyme (E1), repeat | 91.52 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 91.48 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 91.46 | |
| TIGR03023 | 451 | WcaJ_sugtrans Undecaprenyl-phosphate glucose phosp | 91.45 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 91.43 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 91.4 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.39 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 91.36 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 91.35 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 91.34 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 91.33 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 91.31 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 91.26 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 91.26 | |
| COG1042 | 598 | Acyl-CoA synthetase (NDP forming) [Energy producti | 91.24 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 91.24 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 91.23 | |
| KOG1371 | 343 | consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo | 91.21 | |
| PRK14573 | 809 | bifunctional D-alanyl-alanine synthetase A/UDP-N-a | 91.2 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 91.17 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 91.13 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 91.13 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 91.11 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 91.1 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 91.09 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 91.08 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 91.07 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 91.03 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 91.01 | |
| PF13727 | 175 | CoA_binding_3: CoA-binding domain; PDB: 3NKL_B. | 91.01 | |
| cd03466 | 429 | Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup | 91.0 | |
| COG2344 | 211 | AT-rich DNA-binding protein [General function pred | 90.96 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 90.95 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 90.95 | |
| TIGR02717 | 447 | AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP | 90.94 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 90.93 | |
| cd00755 | 231 | YgdL_like Family of activating enzymes (E1) of ubi | 90.86 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 90.8 | |
| PRK12446 | 352 | undecaprenyldiphospho-muramoylpentapeptide beta-N- | 90.78 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 90.77 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 90.75 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 90.74 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 90.74 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 90.73 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 90.73 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 90.7 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 90.68 | |
| PRK09620 | 229 | hypothetical protein; Provisional | 90.67 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 90.66 | |
| TIGR02049 | 403 | gshA_ferroox glutamate--cysteine ligase, T. ferroo | 90.66 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 90.66 | |
| PRK05717 | 255 | oxidoreductase; Validated | 90.6 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 90.6 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 90.59 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 90.55 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 90.55 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 90.53 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 90.52 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 90.51 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 90.49 | |
| PF04174 | 330 | CP_ATPgrasp_1: A circularly permuted ATPgrasp ; In | 90.48 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.48 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 90.47 | |
| PRK05678 | 291 | succinyl-CoA synthetase subunit alpha; Validated | 90.46 | |
| PRK00124 | 151 | hypothetical protein; Validated | 90.46 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 90.45 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 90.42 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 90.34 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 90.29 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 90.29 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.23 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 90.23 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 90.19 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 90.16 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 90.16 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 90.04 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 90.01 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 89.99 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 89.98 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 89.97 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 89.96 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 89.96 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 89.9 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 89.89 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 89.85 | |
| PRK08309 | 177 | short chain dehydrogenase; Provisional | 89.84 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 89.84 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 89.83 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 89.82 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 89.77 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 89.74 | |
| COG1671 | 150 | Uncharacterized protein conserved in bacteria [Fun | 89.71 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 89.7 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 89.7 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 89.66 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 89.66 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.63 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 89.6 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.59 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 89.52 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 89.52 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 89.48 | |
| TIGR01285 | 432 | nifN nitrogenase molybdenum-iron cofactor biosynth | 89.47 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 89.43 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 89.42 | |
| KOG2158 | 565 | consensus Tubulin-tyrosine ligase-related protein | 89.39 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.37 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 89.34 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 89.32 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 89.24 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 89.22 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 89.22 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 89.19 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 89.13 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 89.13 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 89.1 | |
| PLN02871 | 465 | UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | 89.08 | |
| PF02639 | 130 | DUF188: Uncharacterized BCR, YaiI/YqxD family COG1 | 89.06 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 89.01 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 88.99 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 88.96 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 88.96 | |
| TIGR01283 | 456 | nifE nitrogenase molybdenum-iron cofactor biosynth | 88.89 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 88.88 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 88.84 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 88.82 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 88.78 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 88.77 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 88.77 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 88.73 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 88.66 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 88.65 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 88.63 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 88.62 | |
| cd01965 | 428 | Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_l | 88.55 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 88.49 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 88.49 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 88.49 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 88.48 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 88.47 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 88.45 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 88.42 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 88.42 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 88.41 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 88.38 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 88.32 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 88.3 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 88.28 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 88.25 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 88.23 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 88.21 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 88.16 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 88.13 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 88.11 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 88.11 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 88.1 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.99 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 87.96 | |
| TIGR03022 | 456 | WbaP_sugtrans Undecaprenyl-phosphate galactose pho | 87.95 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 87.93 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 87.92 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 87.92 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 87.91 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 87.87 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 87.87 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 87.82 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 87.81 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 87.81 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 87.79 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 87.76 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.76 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 87.74 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 87.73 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 87.72 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 87.63 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 87.61 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 87.6 | |
| COG4091 | 438 | Predicted homoserine dehydrogenase [Amino acid tra | 87.6 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 87.59 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 87.59 | |
| COG0821 | 361 | gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat | 87.57 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 87.53 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 87.47 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 87.45 | |
| PF13477 | 139 | Glyco_trans_4_2: Glycosyl transferase 4-like | 87.45 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.43 | |
| TIGR01019 | 286 | sucCoAalpha succinyl-CoA synthetase, alpha subunit | 87.39 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 87.39 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 87.36 | |
| PRK04663 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.31 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 87.31 | |
| PRK11579 | 346 | putative oxidoreductase; Provisional | 87.23 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 87.19 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 87.18 | |
| PLN02256 | 304 | arogenate dehydrogenase | 87.15 | |
| cd01976 | 421 | Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: | 87.11 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 87.1 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 87.07 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 86.97 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 86.97 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 86.96 | |
| TIGR02263 | 380 | benz_CoA_red_C benzoyl-CoA reductase, subunit C. T | 86.96 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 86.95 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 86.88 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 86.88 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 86.87 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 86.85 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 86.84 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 86.82 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 86.79 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 86.73 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 86.72 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 86.72 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 86.69 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 86.63 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 86.6 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 86.59 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 86.59 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 86.57 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.5 | |
| PRK14478 | 475 | nitrogenase molybdenum-cofactor biosynthesis prote | 86.48 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 86.48 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 86.45 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 86.41 |
| >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-50 Score=378.75 Aligned_cols=241 Identities=55% Similarity=0.925 Sum_probs=237.9
Q ss_pred cccEEEEEcCCHhHHHHHHHHHHcCCcEEEEecCCCcchhhhhhcCceEEccCCCCCCCcCCHHHHHHHHHhcCCCEEee
Q 021372 70 RQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHP 149 (313)
Q Consensus 70 ~~~~ILIig~g~~a~~v~~al~~~G~~vi~v~~~~~~~~~~~~~ad~~~~v~~~~~~~~~~~~~~l~~~~~~~~id~vip 149 (313)
|++||||.|+|+++++++|+++++|+.+++|+++++..+.+..++|+.+.++|.+..++|++.++|++++++.+.++|+|
T Consensus 1 mf~KiLIANRGEIAcRVIRtar~lGi~tVAVYSdaDa~A~hV~~ADEAv~iGpapaaeSYL~~dkIi~Aa~~tGA~AIHP 80 (645)
T COG4770 1 MFSKILIANRGEIACRVIRTARDLGIRTVAVYSDADADALHVRMADEAVHIGPAPAAESYLDIDKIIDAARRTGAQAIHP 80 (645)
T ss_pred CcceEEEeccchhhHHHHHHHHHcCCceEEEEecCCCCchhhhhcchhhhcCCCchhhhhccHHHHHHHHHHhCcccccC
Confidence 67899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccCcCcccHHHHHHHHHcCCceeCCCHHHHHHhCCHHHHHHHHHHCCCCCCCCCcccCCCHHHHHHHHHHhCCcEEEeec
Q 021372 150 GYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKAT 229 (313)
Q Consensus 150 ~~g~~~e~~~~~~~l~~~gi~~~g~~~~~i~~~~DK~~~~~~l~~~Gip~p~~~~~~~~~~~~~~~~~~~lg~P~VvKP~ 229 (313)
+|||++||+.+++.+++.|+.++||++++|+.+.||...|+++.++|+|+.|+|.....+.+++..+++++|||++||+.
T Consensus 81 GYGFLSENa~FA~a~~~aGlvfIGP~~~aI~aMGdK~~AK~l~~~AgVp~VPG~~g~~qd~~~~~~~A~eiGyPVlIKAs 160 (645)
T COG4770 81 GYGFLSENADFAQAVEDAGLVFIGPSAGAIRAMGDKIAAKKLAAEAGVPTVPGYHGPIQDAAELVAIAEEIGYPVLIKAS 160 (645)
T ss_pred CccccccCHHHHHHHHHCCcEEECCCHHHHHHhccHHHHHHHHHHcCCCccCCCCCcccCHHHHHHHHHhcCCcEEEEec
Confidence 99999999999999999999999999999999999999999999999999999988999999999999999999999999
Q ss_pred cCCCCccEEEeCCHHHHHHHHHHHHHHHHhcCCCCcEEEeeccCCCcEEEEEEEEcCCCCEEEEeeccchhhcccceeEE
Q 021372 230 AGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQVIEIHTHT 309 (313)
Q Consensus 230 ~g~gg~GV~~v~~~~el~~~~~~~~~~~~~~~~~~~vlvEe~I~G~~e~~v~v~~d~~G~vv~~~~r~~s~~r~~~~~ie 309 (313)
.|+||+|++++.+.+|+.+.++..+++...+|+++.+++|+|+.-++++.++++.|++|+++++++|+||+||||||+||
T Consensus 161 aGGGGKGMRvv~~~~e~~e~l~sarrEA~asFGddrv~iEkyl~~PRHIEiQV~aD~HGNvv~LgERdCSlQRRhQKVIE 240 (645)
T COG4770 161 AGGGGKGMRVVETPEEFAEALESARREAKASFGDDRVFIEKYLDKPRHIEIQVFADQHGNVVHLGERDCSLQRRHQKVIE 240 (645)
T ss_pred cCCCCCceEeecCHHHHHHHHHHHHHHHHhhcCCceEehhhhcCCCceEEEEEEecCCCCEEEeeccccchhhhcchhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred e
Q 021372 310 E 310 (313)
Q Consensus 310 ~ 310 (313)
|
T Consensus 241 E 241 (645)
T COG4770 241 E 241 (645)
T ss_pred c
Confidence 8
|
|
| >KOG0238 consensus 3-Methylcrotonyl-CoA carboxylase, biotin-containing subunit/Propionyl-CoA carboxylase, alpha chain/Acetyl-CoA carboxylase, biotin carboxylase subunit [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0439 AccC Biotin carboxylase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08654 pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >COG1038 PycA Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07178 pyruvate carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit | Back alignment and domain information |
|---|
| >PRK08462 biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >PRK08463 acetyl-CoA carboxylase subunit A; Validated | Back alignment and domain information |
|---|
| >PRK05586 biotin carboxylase; Validated | Back alignment and domain information |
|---|
| >PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >KOG0369 consensus Pyruvate carboxylase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12999 pyruvate carboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01235 pyruv_carbox pyruvate carboxylase | Back alignment and domain information |
|---|
| >TIGR02712 urea_carbox urea carboxylase | Back alignment and domain information |
|---|
| >PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated | Back alignment and domain information |
|---|
| >PLN02735 carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 | Back alignment and domain information |
|---|
| >PLN02735 carbamoyl-phosphate synthase | Back alignment and domain information |
|---|
| >PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12767 carbamoyl phosphate synthase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated | Back alignment and domain information |
|---|
| >PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG0368 consensus Acetyl-CoA carboxylase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit | Back alignment and domain information |
|---|
| >TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein | Back alignment and domain information |
|---|
| >PRK07206 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02948 phosphoribosylaminoimidazole carboxylase | Back alignment and domain information |
|---|
| >PRK06395 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR00877 purD phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06849 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK13789 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK00885 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05784 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK01372 ddl D-alanine--D-alanine ligase; Reviewed | Back alignment and domain information |
|---|
| >PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon | Back alignment and domain information |
|---|
| >PLN02257 phosphoribosylamine--glycine ligase | Back alignment and domain information |
|---|
| >PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed | Back alignment and domain information |
|---|
| >PRK14569 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK02186 argininosuccinate lyase; Provisional | Back alignment and domain information |
|---|
| >COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14572 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK14568 vanB D-alanine--D-lactate ligase; Provisional | Back alignment and domain information |
|---|
| >COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase | Back alignment and domain information |
|---|
| >PRK14570 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14571 D-alanyl-alanine synthetase A; Provisional | Back alignment and domain information |
|---|
| >PRK13790 phosphoribosylamine--glycine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK10446 ribosomal protein S6 modification protein; Provisional | Back alignment and domain information |
|---|
| >PRK06524 biotin carboxylase-like protein; Validated | Back alignment and domain information |
|---|
| >TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family | Back alignment and domain information |
|---|
| >PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) | Back alignment and domain information |
|---|
| >PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX | Back alignment and domain information |
|---|
| >PRK14016 cyanophycin synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 | Back alignment and domain information |
|---|
| >PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A | Back alignment and domain information |
|---|
| >KOG0237 consensus Glycinamide ribonucleotide synthetase (GARS)/Aminoimidazole ribonucleotide synthetase (AIRS) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] | Back alignment and domain information |
|---|
| >COG3919 Predicted ATP-grasp enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02068 cya_phycin_syn cyanophycin synthetase | Back alignment and domain information |
|---|
| >PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0370 consensus Multifunctional pyrimidine synthesis protein CAD (includes carbamoyl-phophate synthetase, aspartate transcarbamylase, and glutamine amidotransferase) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type | Back alignment and domain information |
|---|
| >PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 | Back alignment and domain information |
|---|
| >PRK12458 glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 | Back alignment and domain information |
|---|
| >PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] | Back alignment and domain information |
|---|
| >PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis | Back alignment and domain information |
|---|
| >PLN02941 inositol-tetrakisphosphate 1-kinase | Back alignment and domain information |
|---|
| >TIGR01380 glut_syn glutathione synthetase, prokaryotic | Back alignment and domain information |
|---|
| >COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05246 glutathione synthetase; Provisional | Back alignment and domain information |
|---|
| >COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] | Back alignment and domain information |
|---|
| >TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit | Back alignment and domain information |
|---|
| >PF13549 ATP-grasp_5: ATP-grasp domain; PDB: 1WR2_A | Back alignment and domain information |
|---|
| >TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein | Back alignment and domain information |
|---|
| >COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14046 malate--CoA ligase subunit beta; Provisional | Back alignment and domain information |
|---|
| >COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF08442 ATP-grasp_2: ATP-grasp domain; InterPro: IPR013650 The ATP-grasp superfamily currently includes 17 groups of enzymes, catalyzing ATP-dependent ligation of a carboxylate containing molecule to an amino or thiol group-containing molecule [] | Back alignment and domain information |
|---|
| >PLN00124 succinyl-CoA ligase [GDP-forming] subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp | Back alignment and domain information |
|---|
| >PLN02235 ATP citrate (pro-S)-lyase | Back alignment and domain information |
|---|
| >PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 | Back alignment and domain information |
|---|
| >PF02844 GARS_N: Phosphoribosylglycinamide synthetase, N domain; InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6 | Back alignment and domain information |
|---|
| >PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp | Back alignment and domain information |
|---|
| >PF06849 DUF1246: Protein of unknown function (DUF1246); InterPro: IPR010672 The last two steps of de novo purine biosynthesis are: i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP) In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH [] | Back alignment and domain information |
|---|
| >PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase | Back alignment and domain information |
|---|
| >PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 | Back alignment and domain information |
|---|
| >PF14305 ATPgrasp_TupA: TupA-like ATPgrasp | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF11379 DUF3182: Protein of unknown function (DUF3182); InterPro: IPR021519 This family of proteins with unknown function appears to be restricted to Proteobacteria | Back alignment and domain information |
|---|
| >PRK08057 cobalt-precorrin-6x reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00715 precor6x_red precorrin-6x reductase | Back alignment and domain information |
|---|
| >COG2099 CobK Precorrin-6x reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PF02571 CbiJ: Precorrin-6x reductase CbiJ/CobK; InterPro: IPR003723 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >KOG2799 consensus Succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >KOG3895 consensus Synaptic vesicle protein Synapsin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF01820 Dala_Dala_lig_N: D-ala D-ala ligase N-terminus; InterPro: IPR011127 This entry represents the N-terminal region of the D-alanine--D-alanine ligase enzyme (6 | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1447 consensus GTP-specific succinyl-CoA synthetase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06988 putative formyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK05472 redox-sensing transcriptional repressor Rex; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >COG1832 Predicted CoA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG2308 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK10124 putative UDP-glucose lipid carrier transferase; Provisional | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03023 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotransferase | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PF13727 CoA_binding_3: CoA-binding domain; PDB: 3NKL_B | Back alignment and domain information |
|---|
| >cd03466 Nitrogenase_NifN_2 Nitrogenase_nifN_2: A subgroup of the NifN subunit of the NifEN complex: NifN forms an alpha2beta2 tetramer with NifE | Back alignment and domain information |
|---|
| >COG2344 AT-rich DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK09620 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02049 gshA_ferroox glutamate--cysteine ligase, T | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF04174 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; InterPro: IPR007302 This is a domain of unknown function | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05678 succinyl-CoA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK00124 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08309 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1671 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01285 nifN nitrogenase molybdenum-iron cofactor biosynthesis protein NifN | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2158 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase | Back alignment and domain information |
|---|
| >PF02639 DUF188: Uncharacterized BCR, YaiI/YqxD family COG1671; InterPro: IPR003791 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01283 nifE nitrogenase molybdenum-iron cofactor biosynthesis protein NifE | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01965 Nitrogenase_MoFe_beta_like Nitrogenase_MoFe_beta_like: Nitrogenase MoFe protein, beta subunit_like | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >TIGR03022 WbaP_sugtrans Undecaprenyl-phosphate galactose phosphotransferase, WbaP | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11579 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02263 benz_CoA_red_C benzoyl-CoA reductase, subunit C | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14478 nitrogenase molybdenum-cofactor biosynthesis protein NifE; Provisional | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 313 | ||||
| 2vqd_A | 464 | Crystal Structure Of Biotin Carboxylase From Pseudo | 3e-71 | ||
| 2vpq_A | 451 | Crystal Structure Of Biotin Carboxylase From S. Aur | 9e-70 | ||
| 1ulz_A | 451 | Crystal Structure Of The Biotin Carboxylase Subunit | 1e-69 | ||
| 3hb9_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 4e-65 | ||
| 3hbl_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 5e-65 | ||
| 3ho8_A | 1150 | Crystal Structure Of S. Aureus Pyruvate Carboxylase | 5e-65 | ||
| 4hnt_A | 1173 | Crystal Structure Of F403a Mutant Of S. Aureus Pyru | 5e-65 | ||
| 3bg5_A | 1173 | Crystal Structure Of Staphylococcus Aureus Pyruvate | 6e-65 | ||
| 4hnu_A | 1173 | Crystal Structure Of K442e Mutant Of S. Aureus Pyru | 6e-65 | ||
| 3n6r_A | 681 | Crystal Structure Of The Holoenzyme Of Propionyl-co | 7e-65 | ||
| 4hnv_A | 1173 | Crystal Structure Of R54e Mutant Of S. Aureus Pyruv | 3e-64 | ||
| 2dzd_A | 461 | Crystal Structure Of The Biotin Carboxylase Domain | 1e-63 | ||
| 3jzf_A | 486 | Crystal Structure Of Biotin Carboxylase From E. Col | 8e-63 | ||
| 3g8c_A | 444 | Crystal Stucture Of Biotin Carboxylase In Complex W | 1e-62 | ||
| 1dv2_A | 452 | The Structure Of Biotin Carboxylase, Mutant E288k, | 1e-62 | ||
| 1bnc_A | 449 | Three-Dimensional Structure Of The Biotin Carboxyla | 1e-62 | ||
| 3g8d_A | 444 | Crystal Structure Of The Biotin Carboxylase Subunit | 1e-62 | ||
| 3rup_B | 452 | Crystal Structure Of E.Coli Biotin Carboxylase In C | 1e-62 | ||
| 2gpw_A | 469 | Crystal Structure Of The Biotin Carboxylase Subunit | 1e-62 | ||
| 2gps_A | 469 | Crystal Structure Of The Biotin Carboxylase Subunit | 5e-62 | ||
| 3rv4_A | 452 | Crystal Structure Of E.Coli Biotin Carboxylase R16e | 6e-62 | ||
| 3ouz_A | 446 | Crystal Structure Of Biotin Carboxylase-Adp Complex | 1e-59 | ||
| 3tw7_A | 1165 | Structure Of Rhizobium Etli Pyruvate Carboxylase T8 | 3e-59 | ||
| 2qf7_A | 1165 | Crystal Structure Of A Complete Multifunctional Pyr | 3e-59 | ||
| 3va7_A | 1236 | Crystal Structure Of The Kluyveromyces Lactis Urea | 7e-55 | ||
| 3u9s_A | 655 | Crystal Structure Of P. Aeruginosa 3-methylcrotonyl | 2e-48 | ||
| 2yl2_A | 540 | Crystal Structure Of Human Acetyl-Coa Carboxylase 1 | 1e-30 | ||
| 2hjw_A | 573 | Crystal Structure Of The Bc Domain Of Acc2 Length = | 3e-30 | ||
| 3gid_A | 540 | The Biotin Carboxylase (Bc) Domain Of Human Acetyl- | 4e-30 | ||
| 3jrx_A | 587 | Crystal Structure Of The Bc Domain Of Acc2 In Compl | 4e-30 | ||
| 3jrw_A | 587 | Phosphorylated Bc Domain Of Acc2 Length = 587 | 4e-30 | ||
| 1w93_A | 553 | Crystal Structure Of Biotin Carboxylase Domain Of A | 5e-25 | ||
| 1w96_A | 554 | Crystal Structure Of Biotin Carboxylase Domain Of A | 5e-25 | ||
| 2cqy_A | 108 | Solution Structure Of B Domain From Human Propionyl | 8e-18 | ||
| 3r23_A | 307 | Crystal Structure Of D-Alanine--D-Alanine Ligase Fr | 1e-05 | ||
| 3vpd_A | 281 | Lysx From Thermus Thermophilus Complexed With Amp-p | 2e-05 | ||
| 2yrw_A | 451 | Crystal Structure Of Gar Synthetase From Geobacillu | 3e-05 | ||
| 2czg_A | 433 | Crystal Structure Of Probable Phosphoribosylglycina | 5e-05 | ||
| 1uc8_A | 280 | Crystal Structure Of A Lysine Biosynthesis Enzyme, | 1e-04 | ||
| 1jdb_B | 1073 | Carbamoyl Phosphate Synthetase From Escherichia Col | 1e-04 | ||
| 1a9x_A | 1073 | Carbamoyl Phosphate Synthetase: Caught In The Act O | 1e-04 | ||
| 1ce8_A | 1073 | Carbamoyl Phosphate Synthetase From Escherichis Col | 1e-04 | ||
| 2yw2_A | 424 | Crystal Structure Of Gar Synthetase From Aquifex Ae | 2e-04 | ||
| 2qk4_A | 452 | Human Glycinamide Ribonucleotide Synthetase Length | 3e-04 | ||
| 3k5i_A | 403 | Crystal Structure Of N5-Carboxyaminoimidazole Synth | 3e-04 | ||
| 3ax6_A | 380 | Crystal Structure Of N5-Carboxyaminoimidazole Ribon | 3e-04 | ||
| 3k5h_A | 403 | Crystal Structure Of Carboxyaminoimidazole Ribonucl | 4e-04 | ||
| 2xd4_A | 422 | Nucleotide-Bound Structures Of Bacillus Subtilis Gl | 5e-04 | ||
| 2r84_A | 334 | Crystal Structure Of Purp From Pyrococcus Furiosus | 7e-04 |
| >pdb|2VQD|A Chain A, Crystal Structure Of Biotin Carboxylase From Pseudomonas Aeruginosa Complexed With Ampcp Length = 464 | Back alignment and structure |
|
| >pdb|2VPQ|A Chain A, Crystal Structure Of Biotin Carboxylase From S. Aureus Complexed With Amppnp Length = 451 | Back alignment and structure |
| >pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 | Back alignment and structure |
| >pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 | Back alignment and structure |
| >pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 | Back alignment and structure |
| >pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 | Back alignment and structure |
| >pdb|4HNT|A Chain A, Crystal Structure Of F403a Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|4HNU|A Chain A, Crystal Structure Of K442e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|3N6R|A Chain A, Crystal Structure Of The Holoenzyme Of Propionyl-coa Carboxylase (pcc) Length = 681 | Back alignment and structure |
| >pdb|4HNV|A Chain A, Crystal Structure Of R54e Mutant Of S. Aureus Pyruvate Carboxylase Length = 1173 | Back alignment and structure |
| >pdb|2DZD|A Chain A, Crystal Structure Of The Biotin Carboxylase Domain Of Pyruvate Carboxylase Length = 461 | Back alignment and structure |
| >pdb|3JZF|A Chain A, Crystal Structure Of Biotin Carboxylase From E. Coli In Complex With Benzimidazoles Series Length = 486 | Back alignment and structure |
| >pdb|3G8C|A Chain A, Crystal Stucture Of Biotin Carboxylase In Complex With Biotin, Bicarbonate, Adp And Mg Ion Length = 444 | Back alignment and structure |
| >pdb|1DV2|A Chain A, The Structure Of Biotin Carboxylase, Mutant E288k, Complexed With Atp Length = 452 | Back alignment and structure |
| >pdb|1BNC|A Chain A, Three-Dimensional Structure Of The Biotin Carboxylase Subunit Of Acetyl-Coa Carboxylase Length = 449 | Back alignment and structure |
| >pdb|3G8D|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E296a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli Length = 444 | Back alignment and structure |
| >pdb|2GPW|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, F363a Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 | Back alignment and structure |
| >pdb|2GPS|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit, E23r Mutant, Of Acetyl-Coa Carboxylase From Escherichia Coli. Length = 469 | Back alignment and structure |
| >pdb|3OUZ|A Chain A, Crystal Structure Of Biotin Carboxylase-Adp Complex From Campylobacter Jejuni Length = 446 | Back alignment and structure |
| >pdb|3TW7|A Chain A, Structure Of Rhizobium Etli Pyruvate Carboxylase T882a Crystallized Without Acetyl Coenzyme-A Length = 1165 | Back alignment and structure |
| >pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 | Back alignment and structure |
| >pdb|3VA7|A Chain A, Crystal Structure Of The Kluyveromyces Lactis Urea Carboxylase Length = 1236 | Back alignment and structure |
| >pdb|3U9S|A Chain A, Crystal Structure Of P. Aeruginosa 3-methylcrotonyl-coa Carboxylase (mcc) 750 Kd Holoenzyme, Coa Complex Length = 655 | Back alignment and structure |
| >pdb|2YL2|A Chain A, Crystal Structure Of Human Acetyl-Coa Carboxylase 1, Biotin Carboxylase (Bc) Domain Length = 540 | Back alignment and structure |
| >pdb|2HJW|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 Length = 573 | Back alignment and structure |
| >pdb|3GID|A Chain A, The Biotin Carboxylase (Bc) Domain Of Human Acetyl-Coa Carboxylase 2 (Acc2) In Complex With Soraphen A Length = 540 | Back alignment and structure |
| >pdb|3JRX|A Chain A, Crystal Structure Of The Bc Domain Of Acc2 In Complex With Soraphen A Length = 587 | Back alignment and structure |
| >pdb|3JRW|A Chain A, Phosphorylated Bc Domain Of Acc2 Length = 587 | Back alignment and structure |
| >pdb|1W93|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae Length = 553 | Back alignment and structure |
| >pdb|1W96|A Chain A, Crystal Structure Of Biotin Carboxylase Domain Of Acetyl- Coenzyme A Carboxylase From Saccharomyces Cerevisiae In Complex With Soraphen A Length = 554 | Back alignment and structure |
| >pdb|2CQY|A Chain A, Solution Structure Of B Domain From Human Propionyl-Coa Carboxylase Alpha Subunit Length = 108 | Back alignment and structure |
| >pdb|3R23|A Chain A, Crystal Structure Of D-Alanine--D-Alanine Ligase From Bacillus Anthracis Length = 307 | Back alignment and structure |
| >pdb|3VPD|A Chain A, Lysx From Thermus Thermophilus Complexed With Amp-pnp Length = 281 | Back alignment and structure |
| >pdb|2YRW|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus Kaustophilus Length = 451 | Back alignment and structure |
| >pdb|2CZG|A Chain A, Crystal Structure Of Probable Phosphoribosylglycinamide Formyl Transferase (Ph0318) From Pyrococcus Horikoshii Ot3 Length = 433 | Back alignment and structure |
| >pdb|1UC8|A Chain A, Crystal Structure Of A Lysine Biosynthesis Enzyme, Lysx, From Thermus Thermophilus Hb8 Length = 280 | Back alignment and structure |
| >pdb|1JDB|B Chain B, Carbamoyl Phosphate Synthetase From Escherichia Coli Length = 1073 | Back alignment and structure |
| >pdb|1A9X|A Chain A, Carbamoyl Phosphate Synthetase: Caught In The Act Of Glutamine Hydrolysis Length = 1073 | Back alignment and structure |
| >pdb|1CE8|A Chain A, Carbamoyl Phosphate Synthetase From Escherichis Coli With Complexed With The Allosteric Ligand Imp Length = 1073 | Back alignment and structure |
| >pdb|2YW2|A Chain A, Crystal Structure Of Gar Synthetase From Aquifex Aeolicus In Complex With Atp Length = 424 | Back alignment and structure |
| >pdb|2QK4|A Chain A, Human Glycinamide Ribonucleotide Synthetase Length = 452 | Back alignment and structure |
| >pdb|3K5I|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Synthase From Aspergillus Clavatus In Complex With Adp And 5- Aminoimadazole Ribonucleotide Length = 403 | Back alignment and structure |
| >pdb|3AX6|A Chain A, Crystal Structure Of N5-Carboxyaminoimidazole Ribonucleotide Synthetase From Thermotoga Maritima Length = 380 | Back alignment and structure |
| >pdb|3K5H|A Chain A, Crystal Structure Of Carboxyaminoimidazole Ribonucleotide Synthase From Asperigillus Clavatus Complexed With Atp Length = 403 | Back alignment and structure |
| >pdb|2XD4|A Chain A, Nucleotide-Bound Structures Of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase Length = 422 | Back alignment and structure |
| >pdb|2R84|A Chain A, Crystal Structure Of Purp From Pyrococcus Furiosus Complexed With Amp And Aicar Length = 334 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| 2vpq_A | 451 | Acetyl-COA carboxylase; bacteria, ATP-grAsp domain | 1e-166 | |
| 3ouz_A | 446 | Biotin carboxylase; structural genomics, center fo | 1e-166 | |
| 1ulz_A | 451 | Pyruvate carboxylase N-terminal domain; biotin car | 1e-164 | |
| 2w70_A | 449 | Biotin carboxylase; ligase, ATP-binding, fatty aci | 1e-163 | |
| 2dzd_A | 461 | Pyruvate carboxylase; biotin carboxylase, ligase; | 1e-154 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 1e-144 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 1e-141 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 1e-141 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 1e-140 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 1e-135 | |
| 1w96_A | 554 | ACC, acetyl-coenzyme A carboxylase; ligase, obesit | 1e-133 | |
| 3glk_A | 540 | Acetyl-COA carboxylase 2; ATP binding, alternative | 1e-132 | |
| 3jrx_A | 587 | Acetyl-COA carboxylase 2; BC domain, soraphen A, a | 1e-132 | |
| 2cqy_A | 108 | Propionyl-COA carboxylase alpha chain, mitochondri | 2e-63 | |
| 4dim_A | 403 | Phosphoribosylglycinamide synthetase; structural g | 1e-24 | |
| 2pn1_A | 331 | Carbamoylphosphate synthase large subunit; ZP_0053 | 3e-19 | |
| 3vmm_A | 474 | Alanine-anticapsin ligase BACD; ATP-grAsp domain, | 6e-16 | |
| 3aw8_A | 369 | PURK, phosphoribosylaminoimidazole carboxylase, AT | 1e-09 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 1e-09 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 1e-09 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 1e-07 | |
| 2r85_A | 334 | PURP protein PF1517; ATP-grAsp superfamily, unknow | 2e-09 | |
| 2r7k_A | 361 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib | 3e-09 | |
| 2dwc_A | 433 | PH0318, 433AA long hypothetical phosphoribosylglyc | 1e-08 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 1e-08 | |
| 1uc8_A | 280 | LYSX, lysine biosynthesis enzyme; alpha-aminoadipa | 2e-08 | |
| 3eth_A | 355 | Phosphoribosylaminoimidazole carboxylase ATPase su | 4e-08 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 5e-08 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 6e-08 | |
| 2z04_A | 365 | Phosphoribosylaminoimidazole carboxylase ATPase su | 8e-08 | |
| 3ln6_A | 750 | Glutathione biosynthesis bifunctional protein GSH; | 2e-07 | |
| 2fb9_A | 322 | D-alanine:D-alanine ligase; 1.90A {Thermus caldoph | 4e-07 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 4e-07 | |
| 2pvp_A | 367 | D-alanine-D-alanine ligase; 2.40A {Helicobacter py | 5e-07 | |
| 4eg0_A | 317 | D-alanine--D-alanine ligase; structural genomics, | 6e-07 | |
| 1iow_A | 306 | DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho | 7e-07 | |
| 3ufx_B | 397 | Succinyl-COA synthetase beta subunit; ATP-grAsp fo | 9e-07 | |
| 3ax6_A | 380 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 1e-06 | |
| 3r5x_A | 307 | D-alanine--D-alanine ligase; alpha-beta structure, | 1e-06 | |
| 1ehi_A | 377 | LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g | 3e-06 | |
| 3ln7_A | 757 | Glutathione biosynthesis bifunctional protein GSH; | 3e-06 | |
| 3df7_A | 305 | Putative ATP-grAsp superfamily protein; putative p | 7e-06 | |
| 2i87_A | 364 | D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco | 2e-05 | |
| 1e4e_A | 343 | Vancomycin/teicoplanin A-type resistance protein; | 2e-05 | |
| 2p0a_A | 344 | Synapsin-3, synapsin III; neurotransmitter release | 3e-05 | |
| 1i7n_A | 309 | Synapsin II; synapse, phosphorylation, neuropeptid | 4e-05 | |
| 3se7_A | 346 | VANA; alpha-beta structure, D-alanine-D-lactate li | 2e-04 | |
| 3lwb_A | 373 | D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan | 2e-04 | |
| 3tqt_A | 372 | D-alanine--D-alanine ligase; cell envelope; 1.88A | 2e-04 | |
| 3i12_A | 364 | D-alanine-D-alanine ligase A; D-alanyl-alanine syn | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 1wr2_A | 238 | Hypothetical protein PH1789; structural genomics, | 5e-04 | |
| 3e5n_A | 386 | D-alanine-D-alanine ligase A; bacterial blight; 2. | 5e-04 |
| >2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Length = 451 | Back alignment and structure |
|---|
Score = 468 bits (1208), Expect = e-166
Identities = 128/239 (53%), Positives = 171/239 (71%), Gaps = 5/239 (2%)
Query: 72 EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLL 131
+K+L+ANRGEIAVR+IR ++GI VA+YS DKDALH ++ADE+ C+G S SYL
Sbjct: 2 KKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLN 61
Query: 132 IPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARET 191
IPN+LS A S GC +HPGYGFLAENA F E+C + FIGP+ SI+ MG K A+
Sbjct: 62 IPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAE 121
Query: 192 MKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMIKATAGGGGRGMRLAKEPDEFVKLLQ 251
M A VP VPGSDGL++ EA K+A ++G+PV+IKATAGGGG+G+R+A++ E +
Sbjct: 122 MIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFR 181
Query: 252 QAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQ-----VIEI 305
+ EA AFGN G+Y+EK+++N RHIE Q++ D YGNV+H GERDC+IQ ++E
Sbjct: 182 MTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEE 240
|
| >3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Length = 446 | Back alignment and structure |
|---|
| >1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Length = 451 | Back alignment and structure |
|---|
| >2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Length = 449 | Back alignment and structure |
|---|
| >2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Length = 461 | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Length = 681 | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Length = 1165 | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Length = 1236 | Back alignment and structure |
|---|
| >1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Length = 554 | Back alignment and structure |
|---|
| >3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Length = 540 | Back alignment and structure |
|---|
| >3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Length = 587 | Back alignment and structure |
|---|
| >2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Length = 403 | Back alignment and structure |
|---|
| >2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Length = 331 | Back alignment and structure |
|---|
| >3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Length = 474 | Back alignment and structure |
|---|
| >3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Length = 369 | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Length = 403 | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Length = 1073 | Back alignment and structure |
|---|
| >2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Length = 334 | Back alignment and structure |
|---|
| >2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Length = 361 | Back alignment and structure |
|---|
| >2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Length = 433 | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Length = 389 | Back alignment and structure |
|---|
| >1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Length = 280 | Back alignment and structure |
|---|
| >3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Length = 355 | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Length = 377 | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Length = 419 | Back alignment and structure |
|---|
| >3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Length = 750 | Back alignment and structure |
|---|
| >2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Length = 322 | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Length = 391 | Back alignment and structure |
|---|
| >2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Length = 367 | Back alignment and structure |
|---|
| >4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A Length = 317 | Back alignment and structure |
|---|
| >1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Length = 306 | Back alignment and structure |
|---|
| >3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} Length = 397 | Back alignment and structure |
|---|
| >3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Length = 380 | Back alignment and structure |
|---|
| >3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Length = 307 | Back alignment and structure |
|---|
| >1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Length = 377 | Back alignment and structure |
|---|
| >3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Length = 757 | Back alignment and structure |
|---|
| >3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Length = 305 | Back alignment and structure |
|---|
| >2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Length = 364 | Back alignment and structure |
|---|
| >1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Length = 343 | Back alignment and structure |
|---|
| >2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Length = 344 | Back alignment and structure |
|---|
| >1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Length = 309 | Back alignment and structure |
|---|
| >3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Length = 346 | Back alignment and structure |
|---|
| >3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 373 | Back alignment and structure |
|---|
| >3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Length = 372 | Back alignment and structure |
|---|
| >3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Length = 364 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} Length = 238 | Back alignment and structure |
|---|
| >3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Length = 386 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| 3ouz_A | 446 | Biotin carboxylase; structural genomics, center fo | 100.0 | |
| 3jrx_A | 587 | Acetyl-COA carboxylase 2; BC domain, soraphen A, a | 100.0 | |
| 3u9t_A | 675 | MCC alpha, methylcrotonyl-COA carboxylase, alpha-s | 100.0 | |
| 3glk_A | 540 | Acetyl-COA carboxylase 2; ATP binding, alternative | 100.0 | |
| 3n6r_A | 681 | Propionyl-COA carboxylase, alpha subunit; protein | 100.0 | |
| 2dzd_A | 461 | Pyruvate carboxylase; biotin carboxylase, ligase; | 100.0 | |
| 1ulz_A | 451 | Pyruvate carboxylase N-terminal domain; biotin car | 100.0 | |
| 2w70_A | 449 | Biotin carboxylase; ligase, ATP-binding, fatty aci | 100.0 | |
| 2vpq_A | 451 | Acetyl-COA carboxylase; bacteria, ATP-grAsp domain | 100.0 | |
| 3va7_A | 1236 | KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A | 100.0 | |
| 3hbl_A | 1150 | Pyruvate carboxylase; TIM barrel, ligase; HET: BTI | 100.0 | |
| 1w96_A | 554 | ACC, acetyl-coenzyme A carboxylase; ligase, obesit | 100.0 | |
| 2qf7_A | 1165 | Pyruvate carboxylase protein; multi-domain, multi- | 100.0 | |
| 4dim_A | 403 | Phosphoribosylglycinamide synthetase; structural g | 99.97 | |
| 1kjq_A | 391 | GART 2, phosphoribosylglycinamide formyltransferas | 99.97 | |
| 2dwc_A | 433 | PH0318, 433AA long hypothetical phosphoribosylglyc | 99.97 | |
| 4e4t_A | 419 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 99.97 | |
| 3k5i_A | 403 | Phosphoribosyl-aminoimidazole carboxylase; purine | 99.96 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 99.96 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 99.96 | |
| 3aw8_A | 369 | PURK, phosphoribosylaminoimidazole carboxylase, AT | 99.96 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 99.96 | |
| 3vot_A | 425 | L-amino acid ligase, BL00235; ATP-grAsp motif, ATP | 99.96 | |
| 2pn1_A | 331 | Carbamoylphosphate synthase large subunit; ZP_0053 | 99.96 | |
| 4ffl_A | 363 | PYLC; amino acid, biosynthesis of pyrrolysine, iso | 99.95 | |
| 3ax6_A | 380 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 99.95 | |
| 3lp8_A | 442 | Phosphoribosylamine-glycine ligase; ssgcid, NIH, n | 99.95 | |
| 2yrx_A | 451 | Phosphoribosylglycinamide synthetase; glycinamide | 99.95 | |
| 2qk4_A | 452 | Trifunctional purine biosynthetic protein adenosi; | 99.95 | |
| 2ip4_A | 417 | PURD, phosphoribosylamine--glycine ligase; GAR syn | 99.95 | |
| 2yw2_A | 424 | Phosphoribosylamine--glycine ligase; glycinamide r | 99.95 | |
| 3mjf_A | 431 | Phosphoribosylamine--glycine ligase; structural ge | 99.95 | |
| 2xcl_A | 422 | Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- | 99.94 | |
| 4fu0_A | 357 | D-alanine--D-alanine ligase 7; vancomycin resistan | 99.94 | |
| 2z04_A | 365 | Phosphoribosylaminoimidazole carboxylase ATPase su | 99.94 | |
| 4eg0_A | 317 | D-alanine--D-alanine ligase; structural genomics, | 99.94 | |
| 1a9x_A | 1073 | Carbamoyl phosphate synthetase (large chain); amid | 99.94 | |
| 3vmm_A | 474 | Alanine-anticapsin ligase BACD; ATP-grAsp domain, | 99.94 | |
| 3e5n_A | 386 | D-alanine-D-alanine ligase A; bacterial blight; 2. | 99.93 | |
| 3i12_A | 364 | D-alanine-D-alanine ligase A; D-alanyl-alanine syn | 99.93 | |
| 1vkz_A | 412 | Phosphoribosylamine--glycine ligase; TM1250, struc | 99.93 | |
| 1ehi_A | 377 | LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g | 99.93 | |
| 2i87_A | 364 | D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco | 99.93 | |
| 3eth_A | 355 | Phosphoribosylaminoimidazole carboxylase ATPase su | 99.92 | |
| 1iow_A | 306 | DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho | 99.92 | |
| 3k3p_A | 383 | D-alanine--D-alanine ligase; D-alanyl-alanine synt | 99.92 | |
| 3lwb_A | 373 | D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan | 99.92 | |
| 3r5x_A | 307 | D-alanine--D-alanine ligase; alpha-beta structure, | 99.91 | |
| 1e4e_A | 343 | Vancomycin/teicoplanin A-type resistance protein; | 99.91 | |
| 3tqt_A | 372 | D-alanine--D-alanine ligase; cell envelope; 1.88A | 99.91 | |
| 3se7_A | 346 | VANA; alpha-beta structure, D-alanine-D-lactate li | 99.91 | |
| 2fb9_A | 322 | D-alanine:D-alanine ligase; 1.90A {Thermus caldoph | 99.9 | |
| 2pvp_A | 367 | D-alanine-D-alanine ligase; 2.40A {Helicobacter py | 99.88 | |
| 2r85_A | 334 | PURP protein PF1517; ATP-grAsp superfamily, unknow | 99.86 | |
| 1uc8_A | 280 | LYSX, lysine biosynthesis enzyme; alpha-aminoadipa | 99.86 | |
| 2r7k_A | 361 | 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib | 99.85 | |
| 2pbz_A | 320 | Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt | 99.82 | |
| 2cqy_A | 108 | Propionyl-COA carboxylase alpha chain, mitochondri | 99.78 | |
| 1gsa_A | 316 | Glutathione synthetase; ligase; HET: ADP GSH; 2.00 | 99.74 | |
| 3ln7_A | 757 | Glutathione biosynthesis bifunctional protein GSH; | 99.71 | |
| 1z2n_X | 324 | Inositol 1,3,4-trisphosphate 5/6-kinase; inositol | 99.69 | |
| 1wr2_A | 238 | Hypothetical protein PH1789; structural genomics, | 99.67 | |
| 3ln6_A | 750 | Glutathione biosynthesis bifunctional protein GSH; | 99.65 | |
| 3df7_A | 305 | Putative ATP-grAsp superfamily protein; putative p | 99.6 | |
| 1i7n_A | 309 | Synapsin II; synapse, phosphorylation, neuropeptid | 99.59 | |
| 2p0a_A | 344 | Synapsin-3, synapsin III; neurotransmitter release | 99.54 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 99.54 | |
| 2q7d_A | 346 | Inositol-tetrakisphosphate 1-kinase; inositol kina | 99.5 | |
| 3ufx_B | 397 | Succinyl-COA synthetase beta subunit; ATP-grAsp fo | 99.41 | |
| 2nu8_B | 388 | SCS-beta, succinyl-COA synthetase beta chain; citr | 99.4 | |
| 2fp4_B | 395 | Succinyl-COA ligase [GDP-forming] beta-chain, mito | 99.35 | |
| 3t7a_A | 330 | Inositol pyrophosphate kinase; ATP-grAsp fold, tra | 98.99 | |
| 3mwd_A | 425 | ATP-citrate synthase; ATP-grAsp, phosphohistidine, | 98.08 | |
| 3pff_A | 829 | ATP-citrate synthase; phosphohistidine, organic ac | 97.91 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 97.55 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 97.45 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 97.32 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 97.28 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 97.19 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 97.1 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 96.76 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.76 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 96.63 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 96.55 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 96.52 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 96.43 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 96.42 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 96.41 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 96.39 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 96.21 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 96.2 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 96.14 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 96.13 | |
| 3n6x_A | 474 | Putative glutathionylspermidine synthase; domain o | 96.07 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 96.03 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 96.02 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 96.02 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 96.0 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 95.96 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 95.96 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 95.92 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 95.86 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 95.86 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 95.86 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 95.84 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 95.83 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.82 | |
| 3tig_A | 380 | TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si | 95.8 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 95.77 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 95.73 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 95.68 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 95.66 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 95.66 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 95.63 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 95.62 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 95.58 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 95.55 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 95.55 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 95.51 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 95.51 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 95.49 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 95.49 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 95.48 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 95.46 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 95.39 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 95.33 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 95.33 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 95.31 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 95.29 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 95.29 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 95.28 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 95.25 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 95.24 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 95.23 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 95.21 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 95.21 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 95.2 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 95.17 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 95.13 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 95.11 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 95.06 | |
| 3s2u_A | 365 | UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape | 95.05 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 95.04 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 95.03 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 95.02 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 94.97 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 94.95 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 94.95 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 94.94 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 94.93 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 94.92 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 94.91 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 94.89 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 94.89 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 94.87 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 94.85 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 94.84 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 94.84 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 94.8 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 94.79 | |
| 4ea9_A | 220 | Perosamine N-acetyltransferase; beta helix, acetyl | 94.77 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 94.74 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 94.73 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 94.71 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 94.7 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 94.69 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 94.67 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 94.67 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 94.67 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 94.66 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 94.65 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 94.62 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 94.62 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 94.61 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 94.6 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 94.59 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 94.58 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 94.56 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 94.54 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 94.53 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 94.53 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 94.52 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 94.5 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 94.49 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 94.43 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 94.43 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 94.43 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 94.42 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 94.4 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 94.4 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 94.38 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 94.37 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 94.36 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 94.35 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 94.34 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 94.33 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 94.33 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 94.31 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 94.29 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 94.27 | |
| 4hv4_A | 494 | UDP-N-acetylmuramate--L-alanine ligase; MURC, yers | 94.26 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 94.23 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 94.21 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 94.18 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 94.17 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 94.17 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 94.15 | |
| 2aef_A | 234 | Calcium-gated potassium channel MTHK; rossmann fol | 94.15 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 94.14 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 94.11 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 94.11 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 94.11 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 94.1 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 94.08 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 94.06 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 94.05 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 94.02 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 94.02 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 94.01 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 93.96 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 93.96 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 93.94 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 93.93 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 93.93 | |
| 3fbs_A | 297 | Oxidoreductase; structural genomics, PSI2, MCSG, p | 93.92 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 93.92 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 93.91 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 93.91 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 93.9 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 93.9 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 93.89 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 93.89 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 93.87 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 93.86 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 93.85 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 93.84 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 93.83 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 93.83 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 93.81 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 93.81 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 93.78 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 93.77 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 93.76 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 93.75 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 93.75 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 93.74 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 93.73 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 93.72 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 93.67 | |
| 3lzw_A | 332 | Ferredoxin--NADP reductase 2; ferredoxin reductase | 93.67 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 93.65 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 93.65 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 93.65 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 93.64 | |
| 3ihm_A | 430 | Styrene monooxygenase A; rossman fold, anti-parall | 93.61 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 93.6 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 93.59 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 93.58 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 93.57 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 93.57 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 93.56 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 93.52 | |
| 3e82_A | 364 | Putative oxidoreductase; NAD, GFO/IDH/MOCA family, | 93.52 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 93.51 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 93.5 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 93.49 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 93.48 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 93.47 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 93.46 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 93.46 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 93.45 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 93.43 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 93.43 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 93.43 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 93.41 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 93.39 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 93.37 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 93.36 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 93.35 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 93.35 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 93.34 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 93.34 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 93.33 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 93.33 | |
| 3itj_A | 338 | Thioredoxin reductase 1; disulfide B flavoprotein, | 93.31 | |
| 3m6i_A | 363 | L-arabinitol 4-dehydrogenase; medium chain dehydro | 93.31 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 93.28 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 93.23 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 93.23 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 93.22 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 93.22 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 93.22 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 93.19 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 93.18 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 93.18 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 93.18 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 93.17 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 93.17 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 93.16 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 93.15 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 93.15 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 93.13 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 93.12 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 93.1 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 93.07 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 93.06 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 93.05 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 93.05 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 93.04 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 93.04 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 93.02 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 93.01 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 93.01 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 92.99 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 92.99 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 92.96 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 92.94 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 92.92 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 92.91 | |
| 1yvv_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 92.9 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 92.9 | |
| 2ywl_A | 180 | Thioredoxin reductase related protein; uncharacter | 92.9 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 92.89 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 92.88 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 92.86 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 92.83 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 92.83 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 92.81 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 92.8 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 92.8 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 92.79 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 92.74 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 92.72 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 92.7 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 92.66 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 92.65 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 92.64 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 92.6 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 92.59 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 92.58 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 92.58 | |
| 2vou_A | 397 | 2,6-dihydroxypyridine hydroxylase; oxidoreductase, | 92.57 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 92.57 | |
| 3rp8_A | 407 | Flavoprotein monooxygenase; FAD-binding protein, o | 92.57 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 92.55 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 92.55 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 92.53 | |
| 3r9u_A | 315 | Thioredoxin reductase; structural genomics, center | 92.5 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 92.44 | |
| 3ef6_A | 410 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) | 92.42 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 92.42 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 92.41 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 92.4 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 92.4 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 92.39 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 92.37 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 92.36 | |
| 3hyw_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 92.35 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 92.34 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 92.31 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 92.3 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 92.29 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 92.28 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 92.25 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 92.22 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 92.17 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 92.15 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 92.13 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 92.13 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 92.13 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 92.12 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 92.11 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 92.11 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 92.1 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 92.1 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 92.09 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 92.05 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 92.05 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 92.03 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 92.01 | |
| 2zbw_A | 335 | Thioredoxin reductase; redox protein, oxidoreducta | 91.97 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 91.95 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 91.9 | |
| 2x3n_A | 399 | Probable FAD-dependent monooxygenase; oxidoreducta | 91.87 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 91.84 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 91.81 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 91.81 | |
| 1f0k_A | 364 | MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe | 91.78 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 91.75 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 91.72 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 91.71 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 91.68 | |
| 2io8_A | 619 | Bifunctional glutathionylspermidine synthetase/ami | 91.62 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 91.59 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 91.57 | |
| 2bc0_A | 490 | NADH oxidase; flavoprotein, pyridine nucleotide di | 91.56 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 91.55 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 91.53 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 91.51 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 91.51 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 91.49 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 91.48 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 91.46 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 91.45 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 91.45 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 91.42 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 91.37 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 91.36 | |
| 4a9w_A | 357 | Monooxygenase; baeyer-villiger, FAD, oxidoreductas | 91.36 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 91.33 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 91.31 | |
| 1trb_A | 320 | Thioredoxin reductase; oxidoreductase(flavoenzyme) | 91.31 | |
| 4dgk_A | 501 | Phytoene dehydrogenase; the FAD/NAD(P)-binding ros | 91.29 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 91.29 | |
| 4g65_A | 461 | TRK system potassium uptake protein TRKA; structur | 91.28 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 91.26 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 91.24 | |
| 2dq4_A | 343 | L-threonine 3-dehydrogenase; NAD-dependent, oxidor | 91.23 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 91.21 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 91.2 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 91.2 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 91.19 | |
| 2ywr_A | 216 | Phosphoribosylglycinamide formyltransferase; rossm | 91.15 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 91.15 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 91.13 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 91.1 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 91.09 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 91.09 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 91.09 | |
| 3pdi_B | 458 | Nitrogenase MOFE cofactor biosynthesis protein NI; | 91.04 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 91.04 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 91.02 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 91.0 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 90.99 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 90.99 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 90.99 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 90.96 | |
| 3ab1_A | 360 | Ferredoxin--NADP reductase; oxidoreductase, electr | 90.93 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 90.85 | |
| 3auf_A | 229 | Glycinamide ribonucleotide transformylase 1; struc | 90.83 | |
| 1k0i_A | 394 | P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h | 90.82 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 90.81 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 90.79 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 90.78 | |
| 3h28_A | 430 | Sulfide-quinone reductase; monotopic membrane prot | 90.77 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 90.74 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 90.73 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 90.71 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 90.67 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 90.67 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 90.64 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 90.64 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 90.63 | |
| 3tqq_A | 314 | Methionyl-tRNA formyltransferase; protein synthesi | 90.58 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 90.58 | |
| 3d1c_A | 369 | Flavin-containing putative monooxygenase; NP_37310 | 90.56 | |
| 3alj_A | 379 | 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; | 90.56 | |
| 3urh_A | 491 | Dihydrolipoyl dehydrogenase; PSI-biology, structur | 90.5 | |
| 2qa1_A | 500 | PGAE, polyketide oxygenase PGAE; FAD, angucycline, | 90.5 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 90.49 | |
| 2cul_A | 232 | Glucose-inhibited division protein A-related PROT | 90.49 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 90.48 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 90.44 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 90.41 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 90.3 | |
| 3nix_A | 421 | Flavoprotein/dehydrogenase; structural genomics, P | 90.27 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 90.22 | |
| 3oc4_A | 452 | Oxidoreductase, pyridine nucleotide-disulfide FAM; | 90.22 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 90.19 | |
| 1ryi_A | 382 | Glycine oxidase; flavoprotein, protein-inhibitor c | 90.18 | |
| 3e1t_A | 512 | Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro | 90.18 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 90.18 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 90.16 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 90.14 | |
| 2qa2_A | 499 | CABE, polyketide oxygenase CABE; FAD, angucycline, | 90.11 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 90.11 | |
| 3fhl_A | 362 | Putative oxidoreductase; NAD-binding domain, PSI-2 | 90.08 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 90.08 | |
| 3h8l_A | 409 | NADH oxidase; membrane protein, complete form, ros | 90.04 | |
| 3u7q_A | 492 | Nitrogenase molybdenum-iron protein alpha chain; m | 90.01 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 90.01 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 89.97 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 89.88 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 89.86 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 89.83 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 89.82 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 89.77 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 89.77 | |
| 2gf3_A | 389 | MSOX, monomeric sarcosine oxidase; flavoprotein ox | 89.77 | |
| 2q7v_A | 325 | Thioredoxin reductase; rossman fold, FAD, flavopro | 89.75 | |
| 3pdi_A | 483 | Nitrogenase MOFE cofactor biosynthesis protein NI; | 89.71 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 89.7 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 89.7 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 89.69 | |
| 2uzz_A | 372 | N-methyl-L-tryptophan oxidase; N-methyltryptophan | 89.68 | |
| 3cgv_A | 397 | Geranylgeranyl reductase related protein; NP_39399 | 89.68 | |
| 1vdc_A | 333 | NTR, NADPH dependent thioredoxin reductase; hypoth | 89.67 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 89.66 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 89.61 | |
| 3nks_A | 477 | Protoporphyrinogen oxidase; FAD containing protein | 89.61 |
| >3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-40 Score=319.83 Aligned_cols=244 Identities=52% Similarity=0.894 Sum_probs=227.8
Q ss_pred ccccccEEEEEcCCHhHHHHHHHHHHcCCcEEEEecCCCcchhhhhhcCceEEccCCCCCCCcCCHHHHHHHHHhcCCCE
Q 021372 67 VTCRQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTM 146 (313)
Q Consensus 67 ~~~~~~~ILIig~g~~a~~v~~al~~~G~~vi~v~~~~~~~~~~~~~ad~~~~v~~~~~~~~~~~~~~l~~~~~~~~id~ 146 (313)
..||++||||+|+|.++++++++++++|+++++++++++....+..++|+.+.++|.+..++|.+.+.++++++++++|+
T Consensus 2 n~m~~~kiLI~g~g~~a~~i~~aa~~~G~~~v~v~~~~~~~~~~~~~ad~~~~i~~~~~~~~~~d~~~l~~~~~~~~~d~ 81 (446)
T 3ouz_A 2 NAMEIKSILIANRGEIALRALRTIKEMGKKAICVYSEADKDALYLKYADASICIGKARSSESYLNIPAIIAAAEIAEADA 81 (446)
T ss_dssp CTTCCCEEEECCCHHHHHHHHHHHHHTTCEEEEEEEGGGTTCTHHHHSSEEEEEECCTTTTGGGCHHHHHHHHHHHTCSE
T ss_pred CccccceEEEECCCHHHHHHHHHHHHcCCEEEEEEcCcccccchHhhCCEEEEcCCCCccccccCHHHHHHHHHHhCcCE
Confidence 35678999999999999999999999999999999888888888999999998887788888999999999999999999
Q ss_pred EeeccCcCcccHHHHHHHHHcCCceeCCCHHHHHHhCCHHHHHHHHHHCCCCCCCCCcccCCCHHHHHHHHHHhCCcEEE
Q 021372 147 LHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGDKSTARETMKNAGVPTVPGSDGLLQSTEEAVKLADELGFPVMI 226 (313)
Q Consensus 147 vip~~g~~~e~~~~~~~l~~~gi~~~g~~~~~i~~~~DK~~~~~~l~~~Gip~p~~~~~~~~~~~~~~~~~~~lg~P~Vv 226 (313)
|+|++++++|+..+++.+++.|++++||+++++..+.||..++++|+++|||+|+++...+.+.+++.++++++|||+|+
T Consensus 82 i~p~~g~~~e~~~~~~~~~~~g~~~~g~~~~~~~~~~dK~~~~~~l~~~Gip~p~~~~~~~~~~~e~~~~~~~~g~Pvvv 161 (446)
T 3ouz_A 82 IFPGYGFLSENQNFVEICAKHNIKFIGPSVEAMNLMSDKSKAKQVMQRAGVPVIPGSDGALAGAEAAKKLAKEIGYPVIL 161 (446)
T ss_dssp EECCSSTTTTCHHHHHHHHHTTCEESSCCHHHHHHHHSHHHHHHHHHHTTCCBCSBCSSSCCSHHHHHHHHHHHCSSEEE
T ss_pred EEECCcccccCHHHHHHHHHCCCceECcCHHHHHHhCCHHHHHHHHHHcCCCcCCCcccCCCCHHHHHHHHHHhCCCEEE
Confidence 99999999999999999999999999999999999999999999999999999998533678999999999999999999
Q ss_pred eeccCCCCccEEEeCCHHHHHHHHHHHHHHHHhcCCCCcEEEeeccCCCcEEEEEEEEcCCCCEEEEeeccchhhcccce
Q 021372 227 KATAGGGGRGMRLAKEPDEFVKLLQQAKSEAAAAFGNDGVYLEKYVQNPRHIEFQVLADKYGNVVHFGERDCSIQVIEIH 306 (313)
Q Consensus 227 KP~~g~gg~GV~~v~~~~el~~~~~~~~~~~~~~~~~~~vlvEe~I~G~~e~~v~v~~d~~G~vv~~~~r~~s~~r~~~~ 306 (313)
||..|+||+||+++++.+|+.++++.+.......+++.++++||||+|++|++++++.|++|+++++++++|+++|++++
T Consensus 162 Kp~~g~gg~Gv~~v~~~~el~~~~~~~~~~~~~~~~~~~~lvEe~i~g~~e~~v~v~~d~~g~~~~~~~~~~~~~~~~~~ 241 (446)
T 3ouz_A 162 KAAAGGGGRGMRVVENEKDLEKAYWSAESEAMTAFGDGTMYMEKYIQNPRHIEVQVIGDSFGNVIHVGERDCSMQRRHQK 241 (446)
T ss_dssp EETTCCTTCSEEEECSGGGHHHHHHHHHHHHHHHHSCCCEEEEECCSSCEEEEEEEEECTTSCEEEEEEEEEEEEETTEE
T ss_pred EECCCCCCCCEEEECCHHHHHHHHHHHHHHHHHhcCCCCEEEEeCCCCCcEEEEEEEEcCCCCEEEEeeceeeeeecCce
Confidence 99999999999999999999999999888776667778999999999988999999999999999999999999999998
Q ss_pred eEEe
Q 021372 307 THTE 310 (313)
Q Consensus 307 ~ie~ 310 (313)
.++.
T Consensus 242 ~~~~ 245 (446)
T 3ouz_A 242 LIEE 245 (446)
T ss_dssp EEEE
T ss_pred EEEE
Confidence 8764
|
| >3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* | Back alignment and structure |
|---|
| >3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A | Back alignment and structure |
|---|
| >3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} | Back alignment and structure |
|---|
| >1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 | Back alignment and structure |
|---|
| >2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... | Back alignment and structure |
|---|
| >2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} | Back alignment and structure |
|---|
| >3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* | Back alignment and structure |
|---|
| >1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A | Back alignment and structure |
|---|
| >2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* | Back alignment and structure |
|---|
| >4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} | Back alignment and structure |
|---|
| >1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* | Back alignment and structure |
|---|
| >2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* | Back alignment and structure |
|---|
| >4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A | Back alignment and structure |
|---|
| >3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} | Back alignment and structure |
|---|
| >2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* | Back alignment and structure |
|---|
| >3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A | Back alignment and structure |
|---|
| >2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A | Back alignment and structure |
|---|
| >3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A | Back alignment and structure |
|---|
| >2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* | Back alignment and structure |
|---|
| >4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A | Back alignment and structure |
|---|
| >1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* | Back alignment and structure |
|---|
| >3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* | Back alignment and structure |
|---|
| >3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* | Back alignment and structure |
|---|
| >1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 | Back alignment and structure |
|---|
| >1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 | Back alignment and structure |
|---|
| >2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* | Back alignment and structure |
|---|
| >3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* | Back alignment and structure |
|---|
| >1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* | Back alignment and structure |
|---|
| >3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* | Back alignment and structure |
|---|
| >1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* | Back alignment and structure |
|---|
| >3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} | Back alignment and structure |
|---|
| >2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* | Back alignment and structure |
|---|
| >2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* | Back alignment and structure |
|---|
| >1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* | Back alignment and structure |
|---|
| >2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* | Back alignment and structure |
|---|
| >2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 | Back alignment and structure |
|---|
| >2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A | Back alignment and structure |
|---|
| >3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} | Back alignment and structure |
|---|
| >1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* | Back alignment and structure |
|---|
| >1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* | Back alignment and structure |
|---|
| >2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* | Back alignment and structure |
|---|
| >2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X | Back alignment and structure |
|---|
| >3ufx_B Succinyl-COA synthetase beta subunit; ATP-grAsp fold, ligase; HET: GDP; 2.35A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* | Back alignment and structure |
|---|
| >2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* | Back alignment and structure |
|---|
| >3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* | Back alignment and structure |
|---|
| >3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* | Back alignment and structure |
|---|
| >3pff_A ATP-citrate synthase; phosphohistidine, organic acid, ATP-grAsp, lyase, transferas; HET: TLA ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* | Back alignment and structure |
|---|
| >3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* | Back alignment and structure |
|---|
| >4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >3pdi_B Nitrogenase MOFE cofactor biosynthesis protein NI; nitrogenase cofactor maturation, NIFB, nifdk, NIFH; HET: CZL; 2.40A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tqq_A Methionyl-tRNA formyltransferase; protein synthesis; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* | Back alignment and structure |
|---|
| >3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} | Back alignment and structure |
|---|
| >2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* | Back alignment and structure |
|---|
| >3u7q_A Nitrogenase molybdenum-iron protein alpha chain; multiple rossmann fold domains, reductase, nitrogen fixing, oxidoreductase; HET: HCA ICS 1CL CLF; 1.00A {Azotobacter vinelandii} SCOP: c.92.2.3 PDB: 1g21_A* 1g20_A* 1fp4_A* 1m1n_A* 1l5h_A* 1m1y_A* 1m34_A* 1n2c_A* 2afh_A* 2afi_A* 2afk_A* 2min_A* 3min_A* 3k1a_A* 1h1l_A* 1qgu_A* 1qh1_A* 1qh8_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* | Back alignment and structure |
|---|
| >2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3pdi_A Nitrogenase MOFE cofactor biosynthesis protein NI; nitrogenase cofactor maturation, NIFB, nifdk, NIFH; HET: CZL; 2.40A {Azotobacter vinelandii} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} | Back alignment and structure |
|---|
| >1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 313 | ||||
| d1ulza2 | 114 | c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term | 2e-42 | |
| d1w96a2 | 170 | c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N s | 1e-39 | |
| d2j9ga2 | 114 | c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-term | 2e-39 | |
| d1ulza3 | 214 | d.142.1.2 (A:115-328) Biotin carboxylase (BC), dom | 3e-35 | |
| d2j9ga3 | 216 | d.142.1.2 (A:115-330) Biotin carboxylase (BC), dom | 2e-30 | |
| d2r7ka2 | 238 | d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carbo | 2e-28 | |
| d1a9xa5 | 275 | d.142.1.2 (A:128-402) Carbamoyl phosphate syntheta | 1e-26 | |
| d1a9xa6 | 259 | d.142.1.2 (A:677-935) Carbamoyl phosphate syntheta | 1e-22 | |
| d2r85a2 | 235 | d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carbo | 9e-21 | |
| d1uc8a2 | 192 | d.142.1.7 (A:89-280) Lysine biosynthesis enzyme Ly | 5e-17 | |
| d1w96a3 | 267 | d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M | 2e-14 | |
| d1gsoa3 | 224 | d.142.1.2 (A:104-327) Glycinamide ribonucleotide s | 2e-11 | |
| d1kjqa3 | 206 | d.142.1.2 (A:113-318) Glycinamide ribonucleotide t | 8e-11 | |
| d1i7na2 | 206 | d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus nor | 1e-10 | |
| d1iowa2 | 210 | d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain | 6e-10 | |
| d3etja3 | 198 | d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribo | 1e-09 | |
| d1ehia2 | 228 | d.142.1.1 (A:135-362) D-alanine:D-lactate ligase V | 4e-09 | |
| d1vkza3 | 220 | d.142.1.2 (A:94-313) Glycinamide ribonucleotide sy | 7e-07 | |
| d1e4ea2 | 211 | d.142.1.1 (A:132-342) D-alanine:D-lactate ligase V | 8e-07 | |
| d1eucb2 | 246 | d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta- | 3e-05 | |
| d2nu7b2 | 238 | d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta- | 2e-04 |
| >d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 114 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PreATP-grasp domain superfamily: PreATP-grasp domain family: BC N-terminal domain-like domain: Biotin carboxylase (BC), N-terminal domain species: Aquifex aeolicus [TaxId: 63363]
Score = 140 bits (354), Expect = 2e-42
Identities = 61/113 (53%), Positives = 78/113 (69%), Gaps = 1/113 (0%)
Query: 72 EKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLL 131
K+LVANRGEIAVR+IR E+GIP VA+Y+ ++ A HVKLADE+ IG P +YL
Sbjct: 3 NKVLVANRGEIAVRIIRACKELGIPTVAIYNEVESTARHVKLADEAYMIGTDP-LDTYLN 61
Query: 132 IPNVLSAAISRGCTMLHPGYGFLAENAVFVEMCREHGINFIGPNPDSIRIMGD 184
+++ A+ G +HPGYGFLAENA F +MC E GI FIGP+ I +MGD
Sbjct: 62 KQRIINLALEVGADAIHPGYGFLAENAEFAKMCEEAGITFIGPHWKVIELMGD 114
|
| >d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 | Back information, alignment and structure |
|---|
| >d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 214 | Back information, alignment and structure |
|---|
| >d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Length = 216 | Back information, alignment and structure |
|---|
| >d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 238 | Back information, alignment and structure |
|---|
| >d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 275 | Back information, alignment and structure |
|---|
| >d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Length = 259 | Back information, alignment and structure |
|---|
| >d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Length = 235 | Back information, alignment and structure |
|---|
| >d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Length = 192 | Back information, alignment and structure |
|---|
| >d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 267 | Back information, alignment and structure |
|---|
| >d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Length = 224 | Back information, alignment and structure |
|---|
| >d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 206 | Back information, alignment and structure |
|---|
| >d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Length = 210 | Back information, alignment and structure |
|---|
| >d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Length = 198 | Back information, alignment and structure |
|---|
| >d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Length = 228 | Back information, alignment and structure |
|---|
| >d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Length = 220 | Back information, alignment and structure |
|---|
| >d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Length = 211 | Back information, alignment and structure |
|---|
| >d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 | Back information, alignment and structure |
|---|
| >d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 238 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| d2j9ga2 | 114 | Biotin carboxylase (BC), N-terminal domain {Escher | 99.86 | |
| d1ulza2 | 114 | Biotin carboxylase (BC), N-terminal domain {Aquife | 99.86 | |
| d1a9xa5 | 275 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.85 | |
| d2j9ga3 | 216 | Biotin carboxylase (BC), domain 2 {Escherichia col | 99.85 | |
| d1ulza3 | 214 | Biotin carboxylase (BC), domain 2 {Aquifex aeolicu | 99.84 | |
| d1w96a2 | 170 | Acetyl-CoA carboxylase, BC-N subdomain {Baker's ye | 99.78 | |
| d1vkza3 | 220 | Glycinamide ribonucleotide synthetase (GAR-syn), d | 99.75 | |
| d1w96a3 | 267 | Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye | 99.75 | |
| d1a9xa6 | 259 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.74 | |
| d1gsoa3 | 224 | Glycinamide ribonucleotide synthetase (GAR-syn), d | 99.69 | |
| d1ehia2 | 228 | D-alanine:D-lactate ligase VanA, C-domain {Leucono | 99.65 | |
| d1kjqa3 | 206 | Glycinamide ribonucleotide transformylase PurT, do | 99.62 | |
| d1iowa2 | 210 | D-ala-D-ala ligase, C-domain {Escherichia coli, ge | 99.61 | |
| d2r7ka2 | 238 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 99.61 | |
| d1uc8a2 | 192 | Lysine biosynthesis enzyme LysX ATP-binding domain | 99.6 | |
| d1e4ea2 | 211 | D-alanine:D-lactate ligase VanA, C-domain {Enteroc | 99.58 | |
| d3etja3 | 198 | N5-carboxyaminoimidazole ribonucleotide synthetase | 99.54 | |
| d2r85a2 | 235 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 99.54 | |
| d1i7na2 | 206 | Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 | 99.41 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 99.34 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.31 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 99.28 | |
| d2nu7b2 | 238 | Succinyl-CoA synthetase, beta-chain, N-terminal do | 99.01 | |
| d1eucb2 | 246 | Succinyl-CoA synthetase, beta-chain, N-terminal do | 98.81 | |
| d1gsoa2 | 105 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 98.38 | |
| d1iowa1 | 96 | D-Ala-D-Ala ligase, N-domain {Escherichia coli, ge | 98.31 | |
| d1gsaa2 | 192 | Prokaryotic glutathione synthetase, C-domain {Esch | 98.11 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 97.9 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 97.7 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 97.66 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 97.37 | |
| d1ehia1 | 132 | D-alanine:D-lactate ligase VanA, N-domain {Leucono | 97.35 | |
| d2pbza2 | 213 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 97.23 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.2 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 96.99 | |
| d1e4ea1 | 130 | D-alanine:D-lactate ligase VanA, N-domain {Enteroc | 96.68 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 96.67 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 96.56 | |
| d1uc8a1 | 88 | Lysine biosynthesis enzyme LysX, N-terminal domain | 96.5 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 96.43 | |
| d1vkza2 | 90 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 96.32 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 96.21 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 96.16 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.12 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 96.1 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 96.07 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 95.95 | |
| d2r7ka1 | 123 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 95.82 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.81 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 95.72 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 95.68 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 95.64 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 95.63 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 95.63 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 95.56 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 95.51 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 95.5 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.47 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 95.45 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 95.44 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 95.36 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 95.35 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 95.33 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 95.33 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 95.3 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 95.26 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 95.22 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 95.22 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 95.19 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 95.19 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 95.18 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 95.17 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 95.16 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 95.12 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 95.12 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 95.11 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 95.07 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 95.06 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 95.02 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 95.01 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 95.0 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 94.93 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 94.93 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 94.92 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 94.92 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 94.89 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 94.88 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 94.86 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 94.83 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 94.81 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 94.8 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 94.79 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 94.77 | |
| d2r85a1 | 99 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 94.68 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 94.61 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 94.46 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 94.46 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 94.45 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 94.43 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 94.41 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 94.34 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 94.11 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 94.09 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 94.07 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 93.87 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 93.77 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 93.68 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 93.66 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 93.61 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 93.55 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 93.53 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 93.48 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 93.47 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 93.44 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 93.33 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 93.32 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 93.22 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 93.21 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 93.16 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 93.16 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 93.13 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 93.1 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 93.09 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 93.06 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 93.02 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 93.0 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 92.99 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 92.98 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 92.95 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 92.86 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 92.85 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 92.84 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 92.83 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 92.81 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 92.79 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 92.74 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 92.7 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 92.67 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 92.63 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 92.6 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 92.58 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 92.54 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 92.52 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 92.52 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 92.49 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 92.48 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 92.48 | |
| d1m1na_ | 477 | Nitrogenase iron-molybdenum protein, alpha chain { | 92.43 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 92.41 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 92.4 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 92.24 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 92.12 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 91.99 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 91.92 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 91.92 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 91.91 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 91.86 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 91.86 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 91.8 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 91.77 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 91.69 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 91.68 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 91.65 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 91.64 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 91.56 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 91.45 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 91.44 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 91.44 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 91.34 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 91.24 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 91.2 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 91.2 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 91.2 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 91.13 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 91.11 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 91.07 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 91.02 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 91.01 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 91.0 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 90.85 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 90.84 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 90.82 | |
| d1b74a1 | 105 | Glutamate racemase {Aquifex pyrophilus [TaxId: 271 | 90.78 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 90.71 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 90.69 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 90.64 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 90.64 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 90.59 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 90.57 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 90.4 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 90.37 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 90.29 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 90.22 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 90.22 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 90.11 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 90.08 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 90.06 | |
| d2bw0a2 | 203 | 10-formyltetrahydrofolate dehydrogenase domain 1 { | 90.05 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 90.03 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 90.02 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 89.99 | |
| d2blna2 | 203 | Polymyxin resistance protein ArnA, N-terminal doma | 89.9 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 89.82 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 89.79 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 89.76 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 89.57 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 89.43 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 89.41 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 89.37 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 89.32 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 89.22 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 89.12 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 89.1 | |
| d2pbza1 | 96 | 5-formaminoimidazole-4-carboxamide ribonucleotide | 89.01 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 89.01 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 88.97 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 88.94 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 88.93 | |
| d1mioa_ | 525 | Nitrogenase iron-molybdenum protein, alpha chain { | 88.87 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 88.82 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 88.59 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 88.53 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 88.31 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 88.27 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 88.25 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 88.23 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 88.11 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 88.04 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 88.03 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 88.02 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 87.97 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 87.68 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 87.62 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 87.51 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 87.45 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 87.42 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 87.4 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 87.36 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 87.31 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 86.97 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 86.85 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 86.65 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 86.63 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 86.59 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 86.58 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 86.29 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 86.2 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 86.19 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 86.06 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 86.04 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 85.98 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 85.91 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 85.9 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 85.86 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 85.86 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 85.66 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 85.49 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 85.49 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 85.39 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 84.99 | |
| d1wl8a1 | 188 | GMP synthase subunit A, GuaAA {Archaeon Pyrococcus | 84.94 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 84.75 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 84.67 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 84.65 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 84.49 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 84.48 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 84.31 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 84.26 | |
| d1q0qa2 | 151 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 84.01 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 83.79 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 83.49 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 83.37 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 83.19 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 83.04 | |
| d1gsaa1 | 122 | Prokaryotic glutathione synthetase, N-terminal dom | 83.02 | |
| d2a9va1 | 196 | GMP synthase subunit A, GuaAA {Archaeon Thermoplas | 82.99 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 82.99 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 82.95 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 82.72 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 82.4 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 82.22 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 82.08 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 81.96 | |
| d1fmta2 | 206 | Methionyl-tRNAfmet formyltransferase {Escherichia | 81.81 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 81.77 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 81.59 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 81.52 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 81.51 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 81.3 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 81.09 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 80.93 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 80.15 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 80.03 |
| >d2j9ga2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PreATP-grasp domain superfamily: PreATP-grasp domain family: BC N-terminal domain-like domain: Biotin carboxylase (BC), N-terminal domain species: Escherichia coli [TaxId: 562]
Probab=99.86 E-value=1.2e-21 Score=148.54 Aligned_cols=113 Identities=55% Similarity=0.911 Sum_probs=108.5
Q ss_pred cccEEEEEcCCHhHHHHHHHHHHcCCcEEEEecCCCcchhhhhhcCceEEccCCCCCCCcCCHHHHHHHHHhcCCCEEee
Q 021372 70 RQEKILVANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGEAPSSQSYLLIPNVLSAAISRGCTMLHP 149 (313)
Q Consensus 70 ~~~~ILIig~g~~a~~v~~al~~~G~~vi~v~~~~~~~~~~~~~ad~~~~v~~~~~~~~~~~~~~l~~~~~~~~id~vip 149 (313)
|++||||.++|+++.+++++++++|++++.++++.+..+.+...+|+.+.+++.+..++|++.+.+++++++.++|+|+|
T Consensus 1 m~~kvLIANRGeiA~Ri~ra~~elgi~tvavys~~D~~~~h~~~ade~v~lg~~~~~~sYl~~~~Ii~~A~~~~~dAiHP 80 (114)
T d2j9ga2 1 MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNIPAIISAAEITGAVAIHP 80 (114)
T ss_dssp CCSEEEECCCHHHHHHHHHHHHHHTCEEEEEEEGGGTTCHHHHHSSEEEEEECSSGGGTTTCHHHHHHHHHHHTCSEEEC
T ss_pred CCceeeEecCCHHHHHHHHHHHHhCCceEEEeccccccccceecCCceeecCCCchhhhhcCHHHHHHHHHHhCCceeec
Confidence 68999999999999999999999999999999999999999999999999988777888999999999999999999999
Q ss_pred ccCcCcccHHHHHHHHHcCCceeCCCHHHHHHh
Q 021372 150 GYGFLAENAVFVEMCREHGINFIGPNPDSIRIM 182 (313)
Q Consensus 150 ~~g~~~e~~~~~~~l~~~gi~~~g~~~~~i~~~ 182 (313)
+|||++|+..+++.+++.|+.|+||++++++.+
T Consensus 81 GyGFLSEn~~Fa~~~~~agi~FIGP~~~~i~~m 113 (114)
T d2j9ga2 81 GYGFLSENANFAEQVERSGFIFIGPKAETIRLM 113 (114)
T ss_dssp CSSTTTTCHHHHHHHHHTTCEESSCCHHHHHHH
T ss_pred chhhhhhhHHHHHHHHHCCCEEECcCHHHHHHc
Confidence 999999999999999999999999999999765
|
| >d1ulza2 c.30.1.1 (A:1-114) Biotin carboxylase (BC), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w96a2 c.30.1.1 (A:14-183) Acetyl-CoA carboxylase, BC-N subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} | Back information, alignment and structure |
|---|
| >d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2nu7b2 d.142.1.4 (B:1-238) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eucb2 d.142.1.4 (B:0-245) Succinyl-CoA synthetase, beta-chain, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1iowa1 c.30.1.2 (A:1-96) D-Ala-D-Ala ligase, N-domain {Escherichia coli, gene ddlB [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ehia1 c.30.1.2 (A:3-134) D-alanine:D-lactate ligase VanA, N-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} | Back information, alignment and structure |
|---|
| >d2pbza2 d.142.1.9 (A:100-312) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1e4ea1 c.30.1.2 (A:2-131) D-alanine:D-lactate ligase VanA, N-domain {Enterococcus faecium [TaxId: 1352]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uc8a1 c.30.1.6 (A:1-88) Lysine biosynthesis enzyme LysX, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2r7ka1 c.30.1.8 (A:1-123) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2r85a1 c.30.1.8 (A:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1m1na_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2bw0a2 c.65.1.1 (A:1-203) 10-formyltetrahydrofolate dehydrogenase domain 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pbza1 c.30.1.8 (A:4-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Thermococcus kodakaraensis [TaxId: 311400]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1mioa_ c.92.2.3 (A:) Nitrogenase iron-molybdenum protein, alpha chain {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1wl8a1 c.23.16.1 (A:1-188) GMP synthase subunit A, GuaAA {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsaa1 c.30.1.3 (A:1-122) Prokaryotic glutathione synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d1fmta2 c.65.1.1 (A:1-206) Methionyl-tRNAfmet formyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|