Citrus Sinensis ID: 021388


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
MESIGVLMACPMNTYLEQELERRFNLFKFWTVSDKTQFLKAQQNNIRAVVGNATAGADAELIDALPKLEIVSSFSVGLDKVDMVKCKEKGVRVTNTPDVLTDDVADLAIGLMLAVLRRLCESDRYVRSGKWKKGDYKLTTKFTGKTVGIIGLGRIGMAVAKRAEAFSCPINYYSRTEKPNLKYKYYPSVVELASNCHILVVACPLTEETRHIINREVIDALGPKGVLINIGRGPHVDERELVSALVEGRLGGAGLDVFENEPHVPEELFGLENVVLMPHVGSGTVETRKTMADLVLGNLEAHFLNKPLLTPVV
ccccEEEEEccccHHHHHHHHcccEEEEccccccHHHHHHHHcccccEEEEcccccccHHHHHHccccEEEEECccccccccHHHHHHcccEEccccccccHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccEEEEEcccHHHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHHccEEEECccccccccccccHHHHHcccccEEEEEccccccccHHHHHHHHHcccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHccccccccccc
*ESIGVLMACPMNTYLEQELERRFNLFKFWTVSDKTQFLKAQQNNIRAVVGNATAGADAELIDALPKLEIVSSFSVGLDKVDMVKCKEKGVRVTNTPDVLTDDVADLAIGLMLAVLRRLCESDRYVRSGKWKKGDYKLTTKFTGKTVGIIGLGRIGMAVAKRAEAFSCPINYYSRTEKPNLKYKYYPSVVELASNCHILVVACPLTEETRHIINREVIDALGPKGVLINIGRGPHVDERELVSALVEGRLGGAGLDVFENEPHVPEELFGLENVVLMPHVGSGTVETRKTMADLVLGNLEAHFLNKPLLTPVV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESIGVLMACPMNTYLEQELERRFNLFKFWTVSDKTQFLKAQQNNIRAVVGNATAGADAELIDALPKLEIVSSFSVGLDKVDMVKCKEKGVRVTNTPDVLTDDVADLAIGLMLAVLRRLCESDRYVRSGKWKKGDYKLTTKFTGKTVGIIGLGRIGMAVAKRAEAFSCPINYYSRTEKPNLKYKYYPSVVELASNCHILVVACPLTEETRHIINREVIDALGPKGVLINIGRGPHVDERELVSALVEGRLGGAGLDVFENEPHVPEELFGLENVVLMPHVGSGTVETRKTMADLVLGNLEAHFLNKPLLTPVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glyoxylate/hydroxypyruvate reductase A HPR2 Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate (HP) into glycolate and glycerate in the cytoplasm, thus providing a cytosolic bypass to the photorespiratory core cycle. Mostly active in the presence of NADPH and hydroxypyruvate.confidentQ9CA90
Glyoxylate/hydroxypyruvate reductase B Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.probableB2U573
Glyoxylate/hydroxypyruvate reductase B Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively.probableA4W577

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BA1, chain A
Confidence level:very confident
Coverage over the Query: 2-313
View the alignment between query and template
View the model in PyMOL