Citrus Sinensis ID: 021390


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310---
MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVLTEQNTPVSSRRND
cHHHHHHcccccEEEEccccccEEEcccccHHHHHHHHHHHHHHHcccccccccEEEEccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccccccccccccccEEccEEEcccccccccHHccccccccccEEcccHHHHHHHHcccccccccccccccHHHHHHHHHHcccccEEEcccccccccccccccccccccccccccHHHHHHHHHccEEEEccccccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccc
cHHHHHHccccEEEEEcccccEEEEcccccHHHHHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHccEcccccccccEcccccHHHHHHHHHHHHHHHHcccEEEEccEEcccEcccccccEccEEEEccccccHHHHccccccEEEEEEEccHHHHHHHHHccccccEEEEEccEHHHHHHHHHHccccEEEEcccccccccccccEcccHHHEEccEccHHHHHHHEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccc
mimrnasktltpvtlelggkdafivcddvdvpHVAQIAVRAALQSsgqncagaerfYVHRDIYALFVSQVAKIVKSvsagpplagkydmgaLCLLEHSEKLQNLVNDALDKGAEILargsfghlsegavdqyfpptvIVNVNHTMKLMqeeafgpimpimkfntDEEVVKLAndsryglgcavfsgSQHRAREIAAQIQCGVAAINDFasnymcqslpfggvkdsgfgrfagvEGLRACCLVKSvvedrwwpyiktkipkpiqypvaenGFEFQESLVEALYGLNIWDRLRALVNVLKVLteqntpvssrrnd
mimrnasktltpvtlELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKsvvedrwwpyiKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLkvlteqntpvssrrnd
MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVLTEQNTPVSSRRND
**********TPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVLT************
MI*RNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNV*****************
MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVLTEQ**********
MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVLTE***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACCLVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVLTEQNTPVSSRRND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query313 2.2.26 [Sep-21-2011]
Q0WSF1596 Aldehyde dehydrogenase 22 yes no 0.996 0.523 0.823 1e-159
P38694644 Putative aldehyde dehydro yes no 0.929 0.451 0.396 2e-54
Q9P7K9522 Putative aldehyde dehydro yes no 0.897 0.538 0.343 1e-47
B0V944490 Betaine aldehyde dehydrog yes no 0.750 0.479 0.370 8e-38
B7I896490 Betaine aldehyde dehydrog yes no 0.750 0.479 0.370 8e-38
B7GYG4490 Betaine aldehyde dehydrog yes no 0.750 0.479 0.370 8e-38
B2HV80490 Betaine aldehyde dehydrog yes no 0.750 0.479 0.370 1e-37
A3M365490 Betaine aldehyde dehydrog yes no 0.750 0.479 0.366 1e-37
B0VST2490 Betaine aldehyde dehydrog yes no 0.750 0.479 0.370 3e-37
P17202497 Betaine aldehyde dehydrog N/A no 0.773 0.486 0.330 2e-36
>sp|Q0WSF1|AL221_ARATH Aldehyde dehydrogenase 22A1 OS=Arabidopsis thaliana GN=ALDH22A1 PE=2 SV=2 Back     alignment and function desciption
 Score =  560 bits (1442), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 257/312 (82%), Positives = 287/312 (91%)

Query: 1   MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHR 60
           MIMRNA++TLTPVTLELGGKDAFI+C+D DV HVAQ+AVR  LQSSGQNCAGAERFYVH+
Sbjct: 283 MIMRNAAETLTPVTLELGGKDAFIICEDADVSHVAQVAVRGTLQSSGQNCAGAERFYVHK 342

Query: 61  DIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGS 120
           DIY  F+ QV KIVKSVSAGPPL G+YDMGA+CL EHSE LQ+LVNDALDKGAEI  RGS
Sbjct: 343 DIYTAFIGQVTKIVKSVSAGPPLTGRYDMGAICLQEHSEHLQSLVNDALDKGAEIAVRGS 402

Query: 121 FGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLG 180
           FGHL E AVDQYFPPTV++NVNH MK+M+EEAFGPIMPIM+F+TDEEV+KLANDSRY LG
Sbjct: 403 FGHLGEDAVDQYFPPTVLINVNHNMKIMKEEAFGPIMPIMQFSTDEEVIKLANDSRYALG 462

Query: 181 CAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC 240
           CAVFSGS+HRA++IA+QIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAG+EGLRACC
Sbjct: 463 CAVFSGSKHRAKQIASQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGIEGLRACC 522

Query: 241 LVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVL 300
           LVKSVVEDR+WP IKTKIPKPIQYPVAEN FEFQE+LVE LYGLNIWDRLR+L++VLK L
Sbjct: 523 LVKSVVEDRFWPLIKTKIPKPIQYPVAENAFEFQEALVETLYGLNIWDRLRSLIDVLKFL 582

Query: 301 TEQNTPVSSRRN 312
           T+Q++ VS  R 
Sbjct: 583 TDQSSNVSRTRK 594





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|P38694|MSC7_YEAST Putative aldehyde dehydrogenase-like protein YHR039C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC7 PE=1 SV=1 Back     alignment and function description
>sp|Q9P7K9|YOSF_SCHPO Putative aldehyde dehydrogenase-like protein C21C3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.15c PE=3 SV=1 Back     alignment and function description
>sp|B0V944|BETB_ACIBY Betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=betB PE=3 SV=1 Back     alignment and function description
>sp|B7I896|BETB_ACIB5 Betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=betB PE=3 SV=1 Back     alignment and function description
>sp|B7GYG4|BETB_ACIB3 Betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=betB PE=3 SV=1 Back     alignment and function description
>sp|B2HV80|BETB_ACIBC Betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=betB PE=3 SV=1 Back     alignment and function description
>sp|A3M365|BETB_ACIBT Betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / NCDC KC 755) GN=betB PE=3 SV=2 Back     alignment and function description
>sp|B0VST2|BETB_ACIBS Betaine aldehyde dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=betB PE=3 SV=1 Back     alignment and function description
>sp|P17202|BADH_SPIOL Betaine aldehyde dehydrogenase, chloroplastic OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
255556370 593 aldehyde dehydrogenase, putative [Ricinu 0.996 0.526 0.875 1e-164
225431946 593 PREDICTED: aldehyde dehydrogenase 22A1 [ 0.996 0.526 0.850 1e-160
357448941 595 Aldehyde dehydrogenase 22A1 [Medicago tr 0.993 0.522 0.848 1e-158
356521770 597 PREDICTED: aldehyde dehydrogenase 22A1-l 1.0 0.524 0.847 1e-158
356556008 597 PREDICTED: aldehyde dehydrogenase 22A1-l 0.996 0.522 0.830 1e-157
42572293 596 aldehyde dehydrogenase 22A1 [Arabidopsis 0.996 0.523 0.823 1e-157
110735945 596 betaine aldehyde dehydrogenase like prot 0.996 0.523 0.823 1e-157
224101571 594 predicted protein [Populus trichocarpa] 1.0 0.526 0.840 1e-156
356564784 596 PREDICTED: aldehyde dehydrogenase 22A1-l 1.0 0.525 0.837 1e-156
356532511 597 PREDICTED: aldehyde dehydrogenase 22A1-l 0.996 0.522 0.830 1e-155
>gi|255556370|ref|XP_002519219.1| aldehyde dehydrogenase, putative [Ricinus communis] gi|223541534|gb|EEF43083.1| aldehyde dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  583 bits (1504), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 274/313 (87%), Positives = 296/313 (94%), Gaps = 1/313 (0%)

Query: 1   MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHR 60
           MIMRNA+ TL PVTLELGGKDAFIVC+DVDVPHVAQIAVRAALQSSGQNCAGAERFYVH+
Sbjct: 282 MIMRNAANTLVPVTLELGGKDAFIVCEDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHK 341

Query: 61  DIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGS 120
           DIY+ FVS+VAKIVKSVSAGPPL G+YDMGA+CL EHS+KLQNLVNDA+DKGA I ARGS
Sbjct: 342 DIYSSFVSEVAKIVKSVSAGPPLTGRYDMGAICLQEHSDKLQNLVNDAIDKGAVIEARGS 401

Query: 121 FGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLG 180
           FGHL EGAVDQYFPPT++VNVNHTMKLM+EE FGPIMPIMKF+TDEE VKLAND RYGLG
Sbjct: 402 FGHLGEGAVDQYFPPTILVNVNHTMKLMREETFGPIMPIMKFSTDEEAVKLANDCRYGLG 461

Query: 181 CAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC 240
           CAVFSGSQ RA+EIA+QI CGVAAINDFAS YMCQSLPFGGVKDSGFGRFAG+EGLRACC
Sbjct: 462 CAVFSGSQRRAKEIASQIHCGVAAINDFASTYMCQSLPFGGVKDSGFGRFAGIEGLRACC 521

Query: 241 LVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVL 300
           LVKSVVEDRWWPYIKTKIPKPIQYPV+ENGFEFQESLVEALYGLNIWDRLRALVNVLK+L
Sbjct: 522 LVKSVVEDRWWPYIKTKIPKPIQYPVSENGFEFQESLVEALYGLNIWDRLRALVNVLKML 581

Query: 301 TEQNTPVSSRRND 313
           +EQN+   ++RND
Sbjct: 582 SEQNSS-GNKRND 593




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225431946|ref|XP_002277743.1| PREDICTED: aldehyde dehydrogenase 22A1 [Vitis vinifera] gi|296083253|emb|CBI22889.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|357448941|ref|XP_003594746.1| Aldehyde dehydrogenase 22A1 [Medicago truncatula] gi|124359955|gb|ABN07971.1| Aldehyde dehydrogenase [Medicago truncatula] gi|355483794|gb|AES64997.1| Aldehyde dehydrogenase 22A1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356521770|ref|XP_003529524.1| PREDICTED: aldehyde dehydrogenase 22A1-like [Glycine max] Back     alignment and taxonomy information
>gi|356556008|ref|XP_003546319.1| PREDICTED: aldehyde dehydrogenase 22A1-like [Glycine max] Back     alignment and taxonomy information
>gi|42572293|ref|NP_974242.1| aldehyde dehydrogenase 22A1 [Arabidopsis thaliana] gi|118595572|sp|Q0WSF1.2|AL221_ARATH RecName: Full=Aldehyde dehydrogenase 22A1; AltName: Full=Novel aldehyde dehydrogenase family 22 member A1; Flags: Precursor gi|42406419|emb|CAE48165.1| putative aldehyde dehydrogenase [Arabidopsis thaliana] gi|332640912|gb|AEE74433.1| aldehyde dehydrogenase 22A1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110735945|dbj|BAE99947.1| betaine aldehyde dehydrogenase like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224101571|ref|XP_002312334.1| predicted protein [Populus trichocarpa] gi|222852154|gb|EEE89701.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356564784|ref|XP_003550628.1| PREDICTED: aldehyde dehydrogenase 22A1-like [Glycine max] Back     alignment and taxonomy information
>gi|356532511|ref|XP_003534815.1| PREDICTED: aldehyde dehydrogenase 22A1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query313
TAIR|locus:2103425596 ALDH22A1 "AT3G66658" [Arabidop 0.993 0.521 0.826 2.9e-142
DICTYBASE|DDB_G0279613589 DDB_G0279613 "aldehyde dehydro 0.926 0.492 0.401 3.3e-56
CGD|CAL0001732614 orf19.1865 [Candida albicans ( 0.932 0.475 0.390 3e-53
SGD|S000001081644 MSC7 "Protein of unknown funct 0.926 0.450 0.404 1e-52
UNIPROTKB|G5EHY1632 MGCH7_ch7g516 "Succinate-semia 0.939 0.465 0.408 4e-51
POMBASE|SPBC21C3.15c522 SPBC21C3.15c "aldehyde dehydro 0.894 0.536 0.349 3e-46
ASPGD|ASPL0000002032642 AN6636 [Emericella nidulans (t 0.939 0.457 0.336 1e-43
TIGR_CMR|CBU_1204458 CBU_1204 "aldehyde dehydrogena 0.757 0.517 0.352 3e-37
UNIPROTKB|F1PAB7494 ALDH9A1 "Uncharacterized prote 0.769 0.487 0.364 1.5e-35
ZFIN|ZDB-GENE-030131-1257508 aldh9a1a.1 "aldehyde dehydroge 0.776 0.478 0.356 2.4e-35
TAIR|locus:2103425 ALDH22A1 "AT3G66658" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1391 (494.7 bits), Expect = 2.9e-142, P = 2.9e-142
 Identities = 257/311 (82%), Positives = 287/311 (92%)

Query:     1 MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHR 60
             MIMRNA++TLTPVTLELGGKDAFI+C+D DV HVAQ+AVR  LQSSGQNCAGAERFYVH+
Sbjct:   283 MIMRNAAETLTPVTLELGGKDAFIICEDADVSHVAQVAVRGTLQSSGQNCAGAERFYVHK 342

Query:    61 DIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGS 120
             DIY  F+ QV KIVKSVSAGPPL G+YDMGA+CL EHSE LQ+LVNDALDKGAEI  RGS
Sbjct:   343 DIYTAFIGQVTKIVKSVSAGPPLTGRYDMGAICLQEHSEHLQSLVNDALDKGAEIAVRGS 402

Query:   121 FGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLG 180
             FGHL E AVDQYFPPTV++NVNH MK+M+EEAFGPIMPIM+F+TDEEV+KLANDSRY LG
Sbjct:   403 FGHLGEDAVDQYFPPTVLINVNHNMKIMKEEAFGPIMPIMQFSTDEEVIKLANDSRYALG 462

Query:   181 CAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC 240
             CAVFSGS+HRA++IA+QIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAG+EGLRACC
Sbjct:   463 CAVFSGSKHRAKQIASQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGIEGLRACC 522

Query:   241 LVKSVVEDRWWPYIKTKIPKPIQYPVAENGFEFQESLVEALYGLNIWDRLRALVNVLKVL 300
             LVKSVVEDR+WP IKTKIPKPIQYPVAEN FEFQE+LVE LYGLNIWDRLR+L++VLK L
Sbjct:   523 LVKSVVEDRFWPLIKTKIPKPIQYPVAENAFEFQEALVETLYGLNIWDRLRSLIDVLKFL 582

Query:   301 TEQNTPVSSRR 311
             T+Q++ VS  R
Sbjct:   583 TDQSSNVSRTR 593




GO:0004028 "3-chloroallyl aldehyde dehydrogenase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
DICTYBASE|DDB_G0279613 DDB_G0279613 "aldehyde dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
CGD|CAL0001732 orf19.1865 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
SGD|S000001081 MSC7 "Protein of unknown function" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|G5EHY1 MGCH7_ch7g516 "Succinate-semialdehyde dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPBC21C3.15c SPBC21C3.15c "aldehyde dehydrogenase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000002032 AN6636 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1204 CBU_1204 "aldehyde dehydrogenase family protein" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAB7 ALDH9A1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1257 aldh9a1a.1 "aldehyde dehydrogenase 9 family, member A1a.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WSF1AL221_ARATH1, ., 2, ., 1, ., 30.82370.99680.5234yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00033134001
SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (593 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 1e-138
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 3e-92
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 6e-92
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 2e-88
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 4e-81
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 3e-76
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 3e-71
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 2e-69
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 2e-69
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 2e-64
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 1e-63
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 2e-63
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 3e-62
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 4e-62
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 2e-61
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 3e-61
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 1e-59
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 3e-58
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 4e-58
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 4e-57
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 9e-57
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 2e-56
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 3e-56
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 2e-55
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 3e-55
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 7e-54
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 1e-53
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 3e-53
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 4e-53
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 6e-53
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 8e-53
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 9e-53
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 1e-52
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 2e-52
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 4e-52
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 1e-51
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 6e-51
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 1e-50
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 5e-50
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 5e-50
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 1e-49
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 2e-49
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 4e-49
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 5e-49
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 1e-48
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 4e-48
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 2e-47
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 2e-47
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 4e-47
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 1e-46
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 3e-46
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 6e-46
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 9e-46
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 2e-45
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 5e-45
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 9e-45
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 1e-43
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 7e-43
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 1e-42
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 2e-42
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 3e-42
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 4e-42
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 6e-42
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 2e-41
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 5e-40
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 2e-39
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 2e-39
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 3e-39
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 6e-39
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 6e-39
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 2e-38
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 7e-38
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 2e-37
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 2e-36
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 3e-36
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 1e-35
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 2e-34
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 2e-33
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 2e-30
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 2e-28
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 3e-28
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 6e-28
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 6e-28
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 7e-28
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 3e-27
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 6e-26
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 5e-25
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 3e-24
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 4e-23
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 1e-22
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 4e-22
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 3e-21
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 1e-20
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 2e-20
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 2e-20
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 3e-18
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 3e-17
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 3e-17
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 4e-16
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 1e-13
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 2e-11
TIGR02278 663 TIGR02278, PaaN-DH, phenylacetic acid degradation 7e-10
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 8e-09
cd07128513 cd07128, ALDH_MaoC-N, N-terminal domain of the mon 1e-07
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 3e-07
PRK11903521 PRK11903, PRK11903, aldehyde dehydrogenase; Provis 1e-04
PRK11563 675 PRK11563, PRK11563, bifunctional aldehyde dehydrog 7e-04
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 0.001
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
 Score =  399 bits (1028), Expect = e-138
 Identities = 127/249 (51%), Positives = 162/249 (65%)

Query: 1   MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHR 60
            +M  A+++LTPV LELGGKD  IV DD D+  +A I +R   QSSGQNC G ER  VH 
Sbjct: 217 KVMAAAAESLTPVVLELGGKDPAIVLDDADLDQIASIIMRGTFQSSGQNCIGIERVIVHE 276

Query: 61  DIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGS 120
            IY   +  +   V+++  GPPL G  D+GA+      ++L+ LV DA++KGA +LA G 
Sbjct: 277 KIYDKLLEILTDRVQALRQGPPLDGDVDVGAMISPARFDRLEELVADAVEKGARLLAGGK 336

Query: 121 FGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLG 180
                E     YFPPT++V+V   MK+ QEE FGP+M +MK + DEE V++AN + YGLG
Sbjct: 337 RYPHPEYPQGHYFPPTLLVDVTPDMKIAQEEVFGPVMVVMKASDDEEAVEIANSTEYGLG 396

Query: 181 CAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC 240
            +VF     RAR IA+Q++ G+ AINDF  NY  Q LPFGGVK SGFGRFAG EGLR  C
Sbjct: 397 ASVFGKDIKRARRIASQLETGMVAINDFGVNYYVQQLPFGGVKGSGFGRFAGEEGLRGLC 456

Query: 241 LVKSVVEDR 249
             KSV EDR
Sbjct: 457 NPKSVTEDR 465


Aldehyde dehydrogenase family members ALDH15A1 (Saccharomyces cerevisiae YHR039C) and ALDH22A1 (Arabidopsis thaliana, EC=1.2.1.3), and similar sequences, are in this CD. Significant improvement of stress tolerance in tobacco plants was observed by overexpressing the ALDH22A1 gene from maize (Zea mays) and was accompanied by a reduction of malondialdehyde derived from cellular lipid peroxidation. Length = 465

>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|131331 TIGR02278, PaaN-DH, phenylacetic acid degradation protein paaN Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237016 PRK11903, PRK11903, aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236931 PRK11563, PRK11563, bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 313
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
KOG2456477 consensus Aldehyde dehydrogenase [Energy productio 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 100.0
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
KOG2454583 consensus Betaine aldehyde dehydrogenase [Energy p 100.0
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
PLN02203484 aldehyde dehydrogenase 100.0
PLN02766501 coniferyl-aldehyde dehydrogenase 100.0
KOG2450501 consensus Aldehyde dehydrogenase [Energy productio 100.0
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
PRK10090409 aldehyde dehydrogenase A; Provisional 100.0
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 100.0
PLN02278498 succinic semialdehyde dehydrogenase 100.0
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
PRK13252488 betaine aldehyde dehydrogenase; Provisional 100.0
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
PLN02466538 aldehyde dehydrogenase family 2 member 100.0
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
PLN02315508 aldehyde dehydrogenase family 7 member 100.0
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
PLN02467503 betaine aldehyde dehydrogenase 100.0
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
KOG2451503 consensus Aldehyde dehydrogenase [Energy productio 100.0
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 100.0
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 100.0
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 100.0
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 100.0
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 100.0
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 100.0
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 100.0
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 100.0
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 100.0
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 100.0
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 100.0
PRK11903521 aldehyde dehydrogenase; Provisional 100.0
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 100.0
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 100.0
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 100.0
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
PRK11809 1318 putA trifunctional transcriptional regulator/proli 100.0
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 100.0
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 100.0
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 100.0
KOG2452881 consensus Formyltetrahydrofolate dehydrogenase [Nu 100.0
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 100.0
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 100.0
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 100.0
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 100.0
PRK15398465 aldehyde dehydrogenase EutE; Provisional 100.0
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 100.0
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 100.0
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 100.0
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 100.0
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 100.0
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 100.0
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 100.0
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 100.0
KOG2455561 consensus Delta-1-pyrroline-5-carboxylate dehydrog 100.0
KOG2453507 consensus Aldehyde dehydrogenase [Energy productio 100.0
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 100.0
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 100.0
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.7
KOG2449157 consensus Methylmalonate semialdehyde dehydrogenas 99.57
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 99.56
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 99.36
KOG4165433 consensus Gamma-glutamyl phosphate reductase [Amin 99.3
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 98.15
PRK00877425 hisD bifunctional histidinal dehydrogenase/ histid 93.97
PLN02926431 histidinol dehydrogenase 93.91
PRK12447426 histidinol dehydrogenase; Reviewed 93.77
TIGR00069393 hisD histidinol dehydrogenase. This model describe 93.38
PRK13770416 histidinol dehydrogenase; Provisional 93.0
COG0141425 HisD Histidinol dehydrogenase [Amino acid transpor 92.96
PF00815412 Histidinol_dh: Histidinol dehydrogenase; InterPro: 92.69
cd06572390 Histidinol_dh Histidinol dehydrogenase, HisD, E.C 90.61
KOG2450 501 consensus Aldehyde dehydrogenase [Energy productio 88.16
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
Probab=100.00  E-value=1.6e-63  Score=481.19  Aligned_cols=273  Identities=26%  Similarity=0.458  Sum_probs=247.6

Q ss_pred             CHHHHhhcCCCCEEEeCCCCCeeEEcCCCCHHHHHHHHHHHHh-cCCCCCceecCEEEEeCCcHHHHHHHHHHHHHhccC
Q 021390            1 MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAAL-QSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSA   79 (313)
Q Consensus         1 ~v~~~aa~~l~pv~lElgG~~p~iV~~dADl~~aa~~i~~~~~-~~~GQ~C~a~~~v~V~~~v~d~f~~~l~~~~~~l~~   79 (313)
                      +|+++|+++++|++||||||||+||++|||++.|++.+++++| .|+||.|++++|||||++++|+|+++|+++++++++
T Consensus       203 ~I~~~aa~~l~~v~LELGGk~p~iV~~dADl~~Aa~~i~~g~f~~n~GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~~~~  282 (484)
T PLN02174        203 VIMAAAAKHLTPVVLELGGKSPVVVDSDTDLKVTVRRIIAGKWGCNNGQACISPDYILTTKEYAPKVIDAMKKELETFYG  282 (484)
T ss_pred             HHHHHHHhcCCcEEEecCCCCeEEEcCCCCHHHHHHHHHHHHhhCCCCCCCCcCcEEEEeHHHHHHHHHHHHHHHHhhcC
Confidence            3789999999999999999999999999999999999999999 699999999999999999999999999999999999


Q ss_pred             CCCCCCCCCcCcccCHHHHHHHHHHHHHHHhcCCeEeeccCCCCCCCCCCCceecceEEeecCCCcccccccccCCceeE
Q 021390           80 GPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPI  159 (313)
Q Consensus        80 g~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~Ga~v~~gg~~~~~~~~~~g~~~~Ptvl~~~~~~~~i~~eE~FGPvl~v  159 (313)
                      |+|.+ ++++||++++.+++++.++|+++ .+|+++++||..     +..|+|++|||+.+++++|++++||+||||++|
T Consensus       283 G~p~~-~~~~Gpli~~~~~~~v~~~i~~a-~~ga~~~~GG~~-----~~~g~~~~PTvl~~v~~~~~i~~eEiFGPVl~v  355 (484)
T PLN02174        283 KNPME-SKDMSRIVNSTHFDRLSKLLDEK-EVSDKIVYGGEK-----DRENLKIAPTILLDVPLDSLIMSEEIFGPLLPI  355 (484)
T ss_pred             CCCcc-cCCcCCCCCHHHHHHHHHHHHHH-HcCCEEEECCCc-----CCCCCEEEEEEEecCCCCChhhcCCcCCCeEEE
Confidence            99977 78999999999999999999997 779999999962     235889999999999999999999999999999


Q ss_pred             EEeCCHHHHHHHHhcCCCCceeEEecCCHHHHHHHHHHhccceEEECCCCCCCCCCCCCccCCCCCCCCCcchHHHHHhh
Q 021390          160 MKFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRAC  239 (313)
Q Consensus       160 ~~~~~~~eai~~~n~~~~gLta~V~s~d~~~~~~~~~~l~~G~v~iN~~~~~~~~~~~pfGG~~~SG~G~~~G~~~l~~f  239 (313)
                      ++|+|++|||+++|+++|||++||||+|.++++++++++++|.|+||++..+...+.+||||+|.||+|++||.+++++|
T Consensus       356 ~~~~~~~eai~~aN~~~~gLaa~vft~d~~~a~~~~~~l~aG~v~IN~~~~~~~~~~~PfGG~k~SG~Gr~~G~~gl~~f  435 (484)
T PLN02174        356 LTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAF  435 (484)
T ss_pred             ecCCCHHHHHHHHhCCCCCeEEEEEcCCHHHHHHHHHcCCcceEEECCCcCCCCCCCCCCCCcCccccCccchHHHHHHh
Confidence            99999999999999999999999999999999999999999999999986654445689999999999999999999999


Q ss_pred             heeeEEEEcccccccccCCCCCCCCCCCc-chHHHHHHHHHHHhcCcHHHHH
Q 021390          240 CLVKSVVEDRWWPYIKTKIPKPIQYPVAE-NGFEFQESLVEALYGLNIWDRL  290 (313)
Q Consensus       240 t~~k~v~~~~~~~~~~~~~p~~~~~p~~~-~~~~~~~~~~~~~~~~~~~~~~  290 (313)
                      |+.|+|++++.+      ...+++|||+. .+.++++.++.    ..|++++
T Consensus       436 t~~K~v~~~~~~------~~~~~~~pp~~~~~~~~~~~~~~----~~~~~~~  477 (484)
T PLN02174        436 SHKKAVLYRSLF------GDSAVRYPPYSRGKLRLLKALVD----SNIFDIF  477 (484)
T ss_pred             cceEEEEECCcc------CcccccCCCCChHHHHHHHHHHh----hchhhhh
Confidence            999999987642      34567888855 46777777765    2555544



>KOG2456 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>KOG2454 consensus Betaine aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>KOG2450 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2451 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>KOG2455 consensus Delta-1-pyrroline-5-carboxylate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2453 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2449 consensus Methylmalonate semialdehyde dehydrogenase [Amino acid transport and metabolism; Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>KOG4165 consensus Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>PRK00877 hisD bifunctional histidinal dehydrogenase/ histidinol dehydrogenase; Reviewed Back     alignment and domain information
>PLN02926 histidinol dehydrogenase Back     alignment and domain information
>PRK12447 histidinol dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00069 hisD histidinol dehydrogenase Back     alignment and domain information
>PRK13770 histidinol dehydrogenase; Provisional Back     alignment and domain information
>COG0141 HisD Histidinol dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF00815 Histidinol_dh: Histidinol dehydrogenase; InterPro: IPR012131 Histidinol dehydrogenase (HDH) catalyzes the terminal step in the biosynthesis of histidine in bacteria, fungi, and plants, the four-electron oxidation of L-histidinol to histidine Back     alignment and domain information
>cd06572 Histidinol_dh Histidinol dehydrogenase, HisD, E Back     alignment and domain information
>KOG2450 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
3iwk_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 1e-38
3iwj_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 4e-38
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 1e-37
3ed6_A520 1.7 Angstrom Resolution Crystal Structure Of Betain 4e-37
4i9b_A517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 1e-36
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 1e-36
4i8q_A514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 8e-36
3ifg_A484 Crystal Structure Of Succinate-Semialdehyde Dehydro 9e-35
3b4w_A495 Crystal Structure Of Mycobacterium Tuberculosis Ald 1e-33
3ty7_A478 Crystal Structure Of Aldehyde Dehydrogenase Family 2e-33
1a4s_A503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 4e-33
3i44_A497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 8e-33
2wox_A489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 2e-31
2wme_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-31
2d4e_A515 Crystal Structure Of The Hpcc From Thermus Thermoph 3e-31
4fr8_A500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 3e-31
2imp_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 4e-31
2hg2_A479 Structure Of Lactaldehyde Dehydrogenase Length = 47 5e-31
1o05_A500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 6e-31
1cw3_A494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 7e-31
3n81_A500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 7e-31
2xdr_A489 Crystallographic Structure Of Betaine Aldehyde Dehy 8e-31
2opx_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 9e-31
3zqa_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-30
2wme_C490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-30
2onn_A500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 3e-30
1nzw_A500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 6e-30
3ros_A484 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 6e-30
3rh9_A506 The Crystal Structure Of Oxidoreductase From Marino 7e-30
3n80_A500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 9e-30
3jz4_A481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 1e-29
3jz4_C481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 1e-29
1zum_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 1e-29
3efv_A462 Crystal Structure Of A Putative Succinate-Semialdeh 2e-29
3k2w_A497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 2e-29
4h7n_A474 The Structure Of Putative Aldehyde Dehydrogenase Pu 2e-29
1ag8_A499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 6e-29
3prl_A505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 9e-29
3inl_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 1e-28
3r31_A517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 1e-28
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 1e-28
1bi9_A499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 2e-28
1bxs_A501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 2e-28
2id2_A475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 1e-27
1euh_A475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 1e-27
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 3e-27
2esd_A475 Crystal Structure Of Thioacylenzyme Intermediate Of 6e-27
4dng_A485 Crystal Structure Of Putative Aldehyde Dehydrogenas 1e-26
1qi1_A475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 1e-26
3pqa_A486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-26
2w8n_A487 The Crytal Structure Of The Oxidized Form Of Human 4e-26
3ek1_A504 Crystal Structure Of Aldehyde Dehydrogenase From Br 5e-26
2o2p_A517 Crystal Structure Of The C-Terminal Domain Of Rat 1 1e-25
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 3e-25
3rhm_A517 Crystal Structure Of The E673q Mutant Of C-Terminal 3e-25
2w8p_A487 The Crystal Structure Of Human C340a Ssadh Length = 5e-25
3rhj_A517 Crystal Structure Of The E673a Mutant Of The C-Term 7e-25
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 1e-24
3rhr_A517 Crystal Structure Of The C707a Mutant Of The C-Term 2e-24
4gnz_A517 Crystal Structure Of The C707s Mutant Of C-terminal 2e-24
3rhl_A517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 9e-24
4dal_A498 Crystal Structure Of Putative Aldehyde Dehydrogenas 6e-23
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 6e-23
3rjl_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 9e-22
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 9e-22
3r64_A508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 3e-20
3lv1_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 6e-20
2jg7_A510 Crystal Structure Of Seabream Antiquitin And Elucid 2e-19
1ky8_A501 Crystal Structure Of The Non-Phosphorylating Glycer 6e-19
2j6l_A500 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 6e-19
1uxv_A501 Structural Basis For Allosteric Regulation And Subs 9e-19
3lns_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 1e-18
2bhp_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 2e-18
1uxn_A501 Structural Basis For Allosteric Regulation And Subs 2e-18
1uzb_A516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 6e-18
2bja_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 2e-17
1t90_A486 Crystal Structure Of Methylmalonate Semialdehyde De 1e-14
4f9i_A1026 Crystal Structure Of Proline Utilization A (Puta) F 5e-14
4e4g_A521 Crystal Structure Of Putative Methylmalonate-Semial 6e-14
3v9j_A563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 5e-12
3v9g_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 8e-11
3v9h_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 1e-10
3v9i_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-10
3ju8_A490 Crystal Structure Of Succinylglutamic Semialdehyde 3e-10
3haz_A1001 Crystal Structure Of Bifunctional Proline Utilizati 4e-09
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure

Iteration: 1

Score = 156 bits (395), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 87/246 (35%), Positives = 134/246 (54%), Gaps = 6/246 (2%) Query: 2 IMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRD 61 IM A++ + PV+LELGGK +V +DVD+ VA+ V ++GQ C+ R VH Sbjct: 246 IMTTAAQLVKPVSLELGGKSPIVVFEDVDLDKVAEWTVFGCFFTNGQICSATSRLIVHES 305 Query: 62 IYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSF 121 I FV ++ K +++ PL +G + +K+ N ++ A +GA IL G Sbjct: 306 IAVEFVDKLVKWAENIKISDPLEEGCRLGPIVSEAQYKKVLNCISSAKSEGATILTGGRR 365 Query: 122 -GHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLG 180 HL +G + PT+I +V +M++ +EE FGP++ + F+T+EE + LAND+ YGLG Sbjct: 366 PEHLKKG---YFVEPTIITDVTTSMQIWREEVFGPVLAVKTFSTEEEAINLANDTHYGLG 422 Query: 181 CAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC 240 AV S R ++ +Q G+ IN +++ P+GG+K SGFGR G GL Sbjct: 423 SAVMSNDLERCERLSKALQAGIVWINCAQPSFI--QAPWGGIKRSGFGRELGEWGLENYL 480 Query: 241 LVKSVV 246 VK V Sbjct: 481 SVKQVT 486
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Lactobacillus Acidophilus Length = 484 Back     alignment and structure
>pdb|3RH9|A Chain A, The Crystal Structure Of Oxidoreductase From Marinobacter Aquaeolei Length = 506 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|2JG7|A Chain A, Crystal Structure Of Seabream Antiquitin And Elucidation Of Its Substrate Specificity Length = 510 Back     alignment and structure
>pdb|1KY8|A Chain A, Crystal Structure Of The Non-Phosphorylating Glyceraldehyde-3- Phosphate Dehydrogenase Length = 501 Back     alignment and structure
>pdb|2J6L|A Chain A, Structure Of Aminoadipate-Semialdehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|1UXV|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ And Benzoate Adduct Length = 457 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|1UXN|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|4E4G|A Chain A, Crystal Structure Of Putative Methylmalonate-Semialdehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 521 Back     alignment and structure
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure
>pdb|3HAZ|A Chain A, Crystal Structure Of Bifunctional Proline Utilization A (Puta) Protein Length = 1001 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query313
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 6e-75
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 8e-75
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 1e-74
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 1e-74
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 2e-73
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 8e-73
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 2e-72
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 2e-72
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 3e-72
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 1e-71
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 2e-71
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 3e-71
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 1e-70
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 2e-70
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 5e-70
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 5e-70
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 9e-70
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 1e-69
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 6e-69
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 8e-68
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 8e-68
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 2e-67
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 4e-67
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 6e-66
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 6e-66
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 2e-63
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 4e-63
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 9e-63
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 1e-62
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 4e-62
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 3e-61
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 2e-60
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 4e-60
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 1e-58
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 6e-58
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 6e-47
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 4e-45
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 6e-41
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 1e-40
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 1e-33
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 3e-29
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 9e-29
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 7e-28
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 7e-28
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 2e-27
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 1e-26
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
 Score =  237 bits (606), Expect = 6e-75
 Identities = 79/247 (31%), Positives = 126/247 (51%), Gaps = 8/247 (3%)

Query: 2   IMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRD 61
           +   A K L   T+ELGG DAFIV DD D   +  +   A   + GQ C  ++R  V + 
Sbjct: 217 VAEAAGKNLKKSTMELGGNDAFIVLDDADPQVLRNVLNDARTYNDGQVCTSSKRIIVEKS 276

Query: 62  IYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSF 121
            Y   + ++  +  ++ AG PL     +  +   +  EKL+  V +A+D GA++  +   
Sbjct: 277 RYDEVLHELKNVFSNLKAGDPLEADTTLPPMNSEKAKEKLEAQVKEAIDAGAKVFYQYP- 335

Query: 122 GHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYGLGC 181
              S+GA   +F PT++ ++     +  +E FGPI  +     D   ++LANDS YGLG 
Sbjct: 336 EIDSKGA---FFRPTILTDIAKDNPVFDKEVFGPIAEVFVVEDDNAAIQLANDSSYGLGS 392

Query: 182 AVFSGSQHRAREIAAQIQCGVAAINDF-ASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC 240
           +V      RA++++AQI+ G+  IN    ++     LPFGG+K SG+GR     GL A  
Sbjct: 393 SVIGSDIDRAKKVSAQIETGMTVINGRWITS---GELPFGGIKKSGYGRELSGLGLMAFV 449

Query: 241 LVKSVVE 247
               V++
Sbjct: 450 NEHLVID 456


>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 100.0
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 100.0
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 100.0
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 100.0
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 100.0
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 100.0
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 100.0
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 100.0
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 100.0
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 100.0
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 100.0
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 100.0
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 100.0
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 100.0
1kae_A434 HDH, histidinol dehydrogenase; L-histidinol dehydr 90.94
4gic_A423 HDH, histidinol dehydrogenase; protein structure i 89.71
2fiu_A99 Conserved hypothetical protein; alpha-beta, dimeri 85.39
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-62  Score=477.14  Aligned_cols=246  Identities=31%  Similarity=0.534  Sum_probs=232.1

Q ss_pred             HHH-HhhcCCCCEEEeCCCCCeeEEcCCCCHHHHHHHHHHHHhcCCCCCceecCEEEEeCCcHHHHHHHHHHHHHhccCC
Q 021390            2 IMR-NASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAG   80 (313)
Q Consensus         2 v~~-~aa~~l~pv~lElgG~~p~iV~~dADl~~aa~~i~~~~~~~~GQ~C~a~~~v~V~~~v~d~f~~~l~~~~~~l~~g   80 (313)
                      |++ ++++++||++||||||||+||++|||++.|++.+++++|.|+||.|++++|||||+++||+|+++|+++++++++|
T Consensus       237 i~~~~a~~~lk~v~lELGGk~p~iV~~dAdl~~A~~~~~~~~~~n~GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~l~vG  316 (490)
T 2wme_A          237 VMASASSSSLKEVTMELGGKSPLIIFPDADLDRAADIAVMANFFSSGQVCTNGTRVFIHRSQQARFEAKVLERVQRIRLG  316 (490)
T ss_dssp             HHHHHHHHHCCEEEEECCCCCEEEECTTSCHHHHHHHHHHHHHGGGGCCTTCCCEEEEEGGGHHHHHHHHHHHHHTCCBS
T ss_pred             HHHhhhccCCceEEEEcCCcCeEEEccCccHHHHHHHHHHHHhccCCCcCCCceeeccchhHHHHHHHHHHHHHHhCcCC
Confidence            444 6678899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCcCcccCHHHHHHHHHHHHHHHhcCCeEeeccCCCCCCCCCCCceecceEEeecCCCcccccccccCCceeEE
Q 021390           81 PPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIM  160 (313)
Q Consensus        81 ~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~Ga~v~~gg~~~~~~~~~~g~~~~Ptvl~~~~~~~~i~~eE~FGPvl~v~  160 (313)
                      +|.++++++||++++.+++++.++|++++++|+++++||..........|+|++|||+.+++++|++++||+||||++|+
T Consensus       317 dp~~~~~~~Gpli~~~~~~rv~~~i~~a~~~Ga~v~~gG~~~~~~~~~~G~~~~Ptvl~~v~~~~~i~~eEiFGPVl~v~  396 (490)
T 2wme_A          317 DPQDENTNFGPLVSFPHMESVLGYIESGKAQKARLLCGGERVTDGAFGKGAYVAPTVFTDCRDDMTIVREEIFGPVMSIL  396 (490)
T ss_dssp             CTTSTTCCBCCCSCHHHHHHHHHHHHHHHHTTCEEEECCSBCCTTTGGGTTCBCCEEEESCCTTSHHHHSCCCSSEEEEE
T ss_pred             CCccccCccCCcCCHHHHHHHHHHHHHHHhcCCEEEECCcccCcccccCCCccCCEEEEcCCCCChhhhccccCCEEEEE
Confidence            99999999999999999999999999999999999999986543334578999999999999999999999999999999


Q ss_pred             EeCCHHHHHHHHhcCCCCceeEEecCCHHHHHHHHHHhccceEEECCCCCCCCCCCCCccCCCCCCCCCcchHHHHHhhh
Q 021390          161 KFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC  240 (313)
Q Consensus       161 ~~~~~~eai~~~n~~~~gLta~V~s~d~~~~~~~~~~l~~G~v~iN~~~~~~~~~~~pfGG~~~SG~G~~~G~~~l~~ft  240 (313)
                      +|+|+||||+++|+++|||+++|||+|.++++++++++++|.|+||++...  .+.+||||+|.||+|+++|++||++||
T Consensus       397 ~~~~~deAi~~aN~~~yGL~a~v~t~d~~~a~~~~~~l~aG~v~iN~~~~~--~~~~PFGG~k~SG~Gre~G~~gl~~ft  474 (490)
T 2wme_A          397 VYDDEDEAIRRANDTEYGLAAGVVTQDLARAHRAIHRLEAGICWINTWGES--PAEMPVGGYKQSGVGRENGLTTLAHYT  474 (490)
T ss_dssp             EESCHHHHHHHHHCSSCCSEEEEECSBHHHHHHHHHHSCCSEEEESCCSCC--CTTSCBCCSGGGEESCBSHHHHHHTTE
T ss_pred             EeCCHHHHHHHHhcCCCCCeEEEEcCCHHHHHHHHHHCCeeEEEEeCCCCC--CCCCCcccccccccCchhHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999986544  346999999999999999999999999


Q ss_pred             eeeEEEEcc
Q 021390          241 LVKSVVEDR  249 (313)
Q Consensus       241 ~~k~v~~~~  249 (313)
                      +.|+|+++.
T Consensus       475 ~~K~v~i~~  483 (490)
T 2wme_A          475 RIKSVQVEL  483 (490)
T ss_dssp             EEEEEEEEC
T ss_pred             ceeEEEEEC
Confidence            999998864



>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>1kae_A HDH, histidinol dehydrogenase; L-histidinol dehydrogenase, homodimer, rossman fold, 4 domai L-histidine biosynthesis, NAD cofactor; HET: HSO NAD; 1.70A {Escherichia coli} SCOP: c.82.1.2 PDB: 1k75_A* 1kah_A* 1kar_A Back     alignment and structure
>4gic_A HDH, histidinol dehydrogenase; protein structure initiative, STR genomics, PSI-biology, NEW YORK structural genomics researc consortium; 2.05A {Methylococcus capsulatus} Back     alignment and structure
>2fiu_A Conserved hypothetical protein; alpha-beta, dimeric alpha-beta barrels, structural genomics, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.58.4.16 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 313
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-66
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-62
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-61
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-56
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 4e-54
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 9e-54
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 1e-52
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-47
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-18
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 1e-17
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Baltic cod (Gadus callarias) [TaxId: 8053]
 Score =  214 bits (545), Expect = 2e-66
 Identities = 80/248 (32%), Positives = 132/248 (53%), Gaps = 4/248 (1%)

Query: 1   MIMRNASKTLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHR 60
            +M  ++KT+  VTLELGGK   ++  D ++ +  + A+ A   + GQ C    R +V R
Sbjct: 248 KVMEMSAKTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCTNGTRVFVQR 307

Query: 61  DIYALFVSQVAKIVKSVSAGPPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGS 120
           +I   F+ +V K  K++  G PL  +  MG L      +K+   V  A  +GA +L  G 
Sbjct: 308 EIMPQFLEEVVKRTKAIVVGDPLLTETRMGGLISKPQLDKVLGFVAQAKKEGARVLCGGE 367

Query: 121 FGHLSEGAVDQ--YFPPTVIVNVNHTMKLMQEEAFGPIMPIMKFNTDEEVVKLANDSRYG 178
               S+  +    +  P V+ N    M  ++EE FGP+M ++ F+T+EEV++ AN++ +G
Sbjct: 368 PLTPSDPKLKNGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVLPFDTEEEVLQRANNTTFG 427

Query: 179 LGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRA 238
           L   VF+    RA  +AA ++ G   IN ++ + +   +PFGG K SGFGR  G   +  
Sbjct: 428 LASGVFTRDISRAHRVAANLEAGTCYINTYSISPV--EVPFGGYKMSGFGRENGQATVDY 485

Query: 239 CCLVKSVV 246
              +K+V+
Sbjct: 486 YSQLKTVI 493


>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query313
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 100.0
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 100.0
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.95
d1k75a_431 L-histidinol dehydrogenase HisD {Escherichia coli 90.43
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00  E-value=4.5e-59  Score=451.96  Aligned_cols=242  Identities=33%  Similarity=0.521  Sum_probs=230.0

Q ss_pred             HHHHhhc-CCCCEEEeCCCCCeeEEcCCCCHHHHHHHHHHHHhcCCCCCceecCEEEEeCCcHHHHHHHHHHHHHhccCC
Q 021390            2 IMRNASK-TLTPVTLELGGKDAFIVCDDVDVPHVAQIAVRAALQSSGQNCAGAERFYVHRDIYALFVSQVAKIVKSVSAG   80 (313)
Q Consensus         2 v~~~aa~-~l~pv~lElgG~~p~iV~~dADl~~aa~~i~~~~~~~~GQ~C~a~~~v~V~~~v~d~f~~~l~~~~~~l~~g   80 (313)
                      |+++|++ ++||+++|||||||+||++|||++.|++.+++++|.|+||.|++++|||||++++|+|+++|+++++++++|
T Consensus       247 i~~~aa~~~~~~~~lElGG~np~iV~~dadl~~a~~~i~~~~~~~~GQ~C~a~~rv~V~~~~~d~f~~~l~~~~~~~~~g  326 (494)
T d1bxsa_         247 IKEAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLG  326 (494)
T ss_dssp             HHHHHHHTTCCEEEEECCCCCEEEECTTSCHHHHHHHHHHHHHTTTTCCTTCCCEEEEEHHHHHHHHHHHHHHHTCCCBS
T ss_pred             HHHHhcccCCCeEEEEcCCcCcEEECcCcchhHhHHHHHHHHhcCCCcccccceEEecccchhHHHHHHHHhhhhheeee
Confidence            6777775 799999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCcCcccCHHHHHHHHHHHHHHHhcCCeEeeccCCCCCCCCCCCceecceEEeecCCCcccccccccCCceeEE
Q 021390           81 PPLAGKYDMGALCLLEHSEKLQNLVNDALDKGAEILARGSFGHLSEGAVDQYFPPTVIVNVNHTMKLMQEEAFGPIMPIM  160 (313)
Q Consensus        81 ~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~Ga~v~~gg~~~~~~~~~~g~~~~Ptvl~~~~~~~~i~~eE~FGPvl~v~  160 (313)
                      ++.++++++||++++++++++.+++++++++|+++++||..    ....|+|++|||+.++++++++++||+||||++|+
T Consensus       327 ~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~Ga~~~~gg~~----~~~~g~~~~Ptvl~~~~~~~~~~~~E~FGPvl~v~  402 (494)
T d1bxsa_         327 NPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGP----WGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIM  402 (494)
T ss_dssp             CTTSTTCCBCCCSCHHHHHHHHHHHHHHHHTTCEECSCCSE----ECSSSCEECCEEEESCCTTSHHHHSCCCSSEEEEE
T ss_pred             ccCCCCCcCCCcCCHHHHHHHHHHHHHHHHcCCEEEeCCCc----cCCCceeEcCEEEeCCCCCcHHHhccccCceEEEE
Confidence            99999999999999999999999999999999999999873    24578999999999999999999999999999999


Q ss_pred             EeCCHHHHHHHHhcCCCCceeEEecCCHHHHHHHHHHhccceEEECCCCCCCCCCCCCccCCCCCCCCCcchHHHHHhhh
Q 021390          161 KFNTDEEVVKLANDSRYGLGCAVFSGSQHRAREIAAQIQCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGVEGLRACC  240 (313)
Q Consensus       161 ~~~~~~eai~~~n~~~~gLta~V~s~d~~~~~~~~~~l~~G~v~iN~~~~~~~~~~~pfGG~~~SG~G~~~G~~~l~~ft  240 (313)
                      +|+|++|||+++|+++|||+++|||+|.+.++++++++++|+|+||++....  +.+||||+|.||+|++||.+|+++||
T Consensus       403 ~~~~~~eai~~~n~~~~gL~a~i~t~d~~~~~~~~~~l~~G~v~iN~~~~~~--~~~PfGG~~~SG~G~~~g~~~~~~ft  480 (494)
T d1bxsa_         403 KFKSLDDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSVVS--AQCPFGGFKMSGNGRELGEYGFHEYT  480 (494)
T ss_dssp             EECCHHHHHHHHHCSSCCSEEEEECSBHHHHHHHHHHSCCSEEEESCCCCCC--TTSCBCCSGGGEESCBSHHHHHHTTE
T ss_pred             EECCHHHHHHHHhCCCCCCeEEEEeCCHHHHHHHHHhCCEeEEEEcCCCCcC--CCCCcCccccccCChhhHHHHHHHhc
Confidence            9999999999999999999999999999999999999999999999875543  46899999999999999999999999


Q ss_pred             eeeEEEEcc
Q 021390          241 LVKSVVEDR  249 (313)
Q Consensus       241 ~~k~v~~~~  249 (313)
                      +.|+|+++.
T Consensus       481 ~~k~i~~~~  489 (494)
T d1bxsa_         481 EVKTVTIKI  489 (494)
T ss_dssp             EEEEEEEEC
T ss_pred             ceEEEEEec
Confidence            999998764



>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k75a_ c.82.1.2 (A:) L-histidinol dehydrogenase HisD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure