Citrus Sinensis ID: 021417


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTIIL
ccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHcccccEEEcccEEEEHHcccccHHHHccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccc
ccHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHcccccHHHHHcccEEEEccHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHcHccccccEEEc
MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAqdlkgkevkvNTSLLYQQTKFNlqreksegyaklgipmsSVEVLEINSKITAACksedqtggRDLVAKIKKWIKESernkrcivdyGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKsgdlsrrrnTVLVLREVISSDHRRVNMFLEIEGAIESLYTLikepicptateaSFVVVYHMItsasaadkpiQKFVDMGLVSLLLETLVDAQRSlcekpwvfstDFAAvitgeerptiil
MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKaqdlkgkevKVNTSLLyqqtkfnlqreksegyaKLGIPMSSVEVLEINSKITaacksedqtggrdLVAKIKKwikesernkrcivDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKsgdlsrrrnTVLVLrevissdhrrvnMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSasaadkpiQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDfaavitgeerptiil
MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTIIL
*****HVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITG********
*****HV*LINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFN****************SSVEVLEINSKITAACK*******RDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEAL**LGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTII*
MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTIIL
*PGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTIIL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGKRHVRLINLAKWLVESAWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQTKFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSLCEKPWVFSTDFAAVITGEERPTIIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
Q5PNY6435 U-box domain-containing p no no 0.644 0.462 0.358 2e-27
Q9C8D1431 U-box domain-containing p no no 0.625 0.452 0.293 2e-20
C1FXW9 1613 THO complex subunit 2 OS= N/A no 0.185 0.035 0.457 2e-05
B2KI97 1576 THO complex subunit 2 OS= N/A no 0.185 0.036 0.457 2e-05
Q8NI27 1593 THO complex subunit 2 OS= yes no 0.185 0.036 0.457 2e-05
B1AZI6 1594 THO complex subunit 2 OS= no no 0.185 0.036 0.457 2e-05
B1MTK1 1600 THO complex subunit 2 OS= N/A no 0.185 0.036 0.457 2e-05
B0KWH8 1600 THO complex subunit 2 OS= yes no 0.185 0.036 0.457 2e-05
>sp|Q5PNY6|PUB21_ARATH U-box domain-containing protein 21 OS=Arabidopsis thaliana GN=PUB21 PE=2 SV=1 Back     alignment and function desciption
 Score =  123 bits (309), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 127/212 (59%), Gaps = 11/212 (5%)

Query: 82  IPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA 141
           +P+   EV EI+ K+++A +  D      ++ KIKK   ESE+N++C+ +     VL   
Sbjct: 114 VPLMPCEVYEISRKLSSATRRGDYEKCGVIIEKIKKLGDESEKNRKCVNENSVGWVLCDC 173

Query: 142 FESFSKTCLDEHVS-VLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRR 200
           F+ FS    DE ++ +L EILS LT +FP+  E ++ L SA+S  C+   LKS D S R+
Sbjct: 174 FDKFSG---DEKLTFMLNEILSLLTWMFPIGLEGISKLASATSFRCVAGLLKSTDDSVRQ 230

Query: 201 NTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAA 260
           N   +++E++S D  RV+ F    G  E+L  LI++ +  ++T++S + +Y M+      
Sbjct: 231 NAAFIMKEILSLDETRVHSFAVENGVAEALVKLIRDSVSSSSTKSSLIAIYQMVLQ---- 286

Query: 261 DKP--IQKFVDMGLVSLLLETLVDAQRSLCEK 290
            KP    +F+++GLVS+ +E +VDA+ S+CEK
Sbjct: 287 -KPEIASEFLEIGLVSITVEMIVDAENSVCEK 317




Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9C8D1|PUB20_ARATH U-box domain-containing protein 20 OS=Arabidopsis thaliana GN=PUB20 PE=2 SV=1 Back     alignment and function description
>sp|C1FXW9|THOC2_DASNO THO complex subunit 2 OS=Dasypus novemcinctus GN=THOC2 PE=3 SV=1 Back     alignment and function description
>sp|B2KI97|THOC2_RHIFE THO complex subunit 2 OS=Rhinolophus ferrumequinum GN=THOC2 PE=3 SV=1 Back     alignment and function description
>sp|Q8NI27|THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens GN=THOC2 PE=1 SV=2 Back     alignment and function description
>sp|B1AZI6|THOC2_MOUSE THO complex subunit 2 OS=Mus musculus GN=Thoc2 PE=3 SV=1 Back     alignment and function description
>sp|B1MTK1|THOC2_CALMO THO complex subunit 2 OS=Callicebus moloch GN=THOC2 PE=3 SV=1 Back     alignment and function description
>sp|B0KWH8|THOC2_CALJA THO complex subunit 2 OS=Callithrix jacchus GN=THOC2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
14582200 442 immediate-early fungal elicitor protein 0.669 0.472 0.542 3e-60
118487984 441 unknown [Populus trichocarpa] 0.666 0.471 0.614 6e-60
255573216 426 Spotted leaf protein, putative [Ricinus 0.625 0.457 0.569 2e-57
359473099 442 PREDICTED: U-box domain-containing prote 0.669 0.472 0.569 2e-55
224077352 448 predicted protein [Populus trichocarpa] 0.698 0.486 0.475 3e-52
224069206 446 predicted protein [Populus trichocarpa] 0.669 0.468 0.473 2e-49
449456206 442 PREDICTED: U-box domain-containing prote 0.669 0.472 0.473 4e-49
449530496 442 PREDICTED: LOW QUALITY PROTEIN: U-box do 0.669 0.472 0.468 1e-48
30013683 445 Avr9/Cf-9 rapidly elicited protein 74 [N 0.717 0.503 0.469 3e-48
449449104 444 PREDICTED: U-box domain-containing prote 0.669 0.470 0.474 1e-47
>gi|14582200|gb|AAK69401.1|AF274564_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] gi|14582202|gb|AAK69402.1|AF274565_1 immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] Back     alignment and taxonomy information
 Score =  238 bits (607), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 164/212 (77%), Gaps = 3/212 (1%)

Query: 82  IPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA 141
           IP+SS +V E+ SK+ AAC+ E+ +  ++LV KIK+ +KE+ERNKRC V  G V VLA+ 
Sbjct: 113 IPVSSHQVTEMLSKVVAACRREEASACQELVGKIKRLVKENERNKRCFVANGTVGVLAST 172

Query: 142 FESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRRN 201
           FE+FSK   D++V+VLEEILS L+L+ PL GEA  +LGS SS++CMVWFLKSGDLS R N
Sbjct: 173 FEAFSKLSFDKNVAVLEEILSCLSLMTPLDGEAKAFLGSNSSLNCMVWFLKSGDLSARAN 232

Query: 202 TVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAA- 260
           +VLVL+ V+S+D +++  F  IEG++E+L  +IKEP+ PT T+AS ++VY+M++++S++ 
Sbjct: 233 SVLVLKHVLSTDQKKMEEFSMIEGSLEALVKVIKEPVSPTTTKASLLIVYYMVSTSSSSR 292

Query: 261 --DKPIQKFVDMGLVSLLLETLVDAQRSLCEK 290
             DK I +F+DMGL+  LLE LVD  +S+CEK
Sbjct: 293 VDDKIIARFIDMGLIERLLEMLVDCDKSICEK 324




Source: Petroselinum crispum

Species: Petroselinum crispum

Genus: Petroselinum

Family: Apiaceae

Order: Apiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118487984|gb|ABK95813.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255573216|ref|XP_002527537.1| Spotted leaf protein, putative [Ricinus communis] gi|223533087|gb|EEF34846.1| Spotted leaf protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359473099|ref|XP_003631249.1| PREDICTED: U-box domain-containing protein 21-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224077352|ref|XP_002305224.1| predicted protein [Populus trichocarpa] gi|222848188|gb|EEE85735.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224069206|ref|XP_002302926.1| predicted protein [Populus trichocarpa] gi|222844652|gb|EEE82199.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449456206|ref|XP_004145841.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449530496|ref|XP_004172231.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30013683|gb|AAP03884.1| Avr9/Cf-9 rapidly elicited protein 74 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|449449104|ref|XP_004142305.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus] gi|449523075|ref|XP_004168550.1| PREDICTED: U-box domain-containing protein 21-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
TAIR|locus:2169861435 AT5G37490 [Arabidopsis thalian 0.644 0.462 0.358 1.4e-30
TAIR|locus:2075457 379 AT3G02840 [Arabidopsis thalian 0.724 0.596 0.336 1.4e-30
TAIR|locus:2013850431 CMPG1 ""CYS, MET, PRO, and GLY 0.628 0.454 0.295 1.8e-21
UNIPROTKB|E1BSI5 1519 THOC2 "Uncharacterized protein 0.173 0.035 0.472 0.00052
RGD|1561623 1570 Thoc2 "THO complex 2" [Rattus 0.173 0.034 0.472 0.00054
UNIPROTKB|Q8NI27 1593 THOC2 "THO complex subunit 2" 0.173 0.033 0.472 0.00054
MGI|MGI:2442413 1594 Thoc2 "THO complex 2" [Mus mus 0.173 0.033 0.472 0.00054
UNIPROTKB|F1RU72 1601 THOC2 "Uncharacterized protein 0.173 0.033 0.472 0.00055
TAIR|locus:2169861 AT5G37490 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 337 (123.7 bits), Expect = 1.4e-30, P = 1.4e-30
 Identities = 76/212 (35%), Positives = 127/212 (59%)

Query:    82 IPMSSVEVLEINSKITAACKSEDQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA 141
             +P+   EV EI+ K+++A +  D      ++ KIKK   ESE+N++C+ +     VL   
Sbjct:   114 VPLMPCEVYEISRKLSSATRRGDYEKCGVIIEKIKKLGDESEKNRKCVNENSVGWVLCDC 173

Query:   142 FESFSKTCLDEHVS-VLEEILSTLTLLFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRR 200
             F+ FS    DE ++ +L EILS LT +FP+  E ++ L SA+S  C+   LKS D S R+
Sbjct:   174 FDKFSG---DEKLTFMLNEILSLLTWMFPIGLEGISKLASATSFRCVAGLLKSTDDSVRQ 230

Query:   201 NTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAA 260
             N   +++E++S D  RV+ F    G  E+L  LI++ +  ++T++S + +Y M+      
Sbjct:   231 NAAFIMKEILSLDETRVHSFAVENGVAEALVKLIRDSVSSSSTKSSLIAIYQMVLQ---- 286

Query:   261 DKP--IQKFVDMGLVSLLLETLVDAQRSLCEK 290
              KP    +F+++GLVS+ +E +VDA+ S+CEK
Sbjct:   287 -KPEIASEFLEIGLVSITVEMIVDAENSVCEK 317




GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0016567 "protein ubiquitination" evidence=IEA
GO:0010200 "response to chitin" evidence=IEP;RCA
GO:0002679 "respiratory burst involved in defense response" evidence=RCA
GO:0009693 "ethylene biosynthetic process" evidence=RCA
GO:0035556 "intracellular signal transduction" evidence=RCA
TAIR|locus:2075457 AT3G02840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013850 CMPG1 ""CYS, MET, PRO, and GLY protein 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSI5 THOC2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1561623 Thoc2 "THO complex 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NI27 THOC2 "THO complex subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2442413 Thoc2 "THO complex 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RU72 THOC2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00030628001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (442 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.88
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.83
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.6
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.41
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.38
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.33
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.29
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.18
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.98
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 98.97
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.92
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 98.89
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.87
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.54
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.46
KOG4199461 consensus Uncharacterized conserved protein [Funct 98.45
KOG1048 717 consensus Neural adherens junction protein Plakoph 98.38
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.32
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 98.23
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.15
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.11
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 98.03
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 97.98
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.67
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 97.63
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 97.58
KOG4199461 consensus Uncharacterized conserved protein [Funct 97.57
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.57
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 97.48
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 97.4
KOG1048 717 consensus Neural adherens junction protein Plakoph 97.3
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.14
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 97.12
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 97.03
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 96.95
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 96.94
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 96.83
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 96.79
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 96.77
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 96.65
PF05536 543 Neurochondrin: Neurochondrin 96.53
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.51
KOG0289 506 consensus mRNA splicing factor [General function p 96.18
KOG4646173 consensus Uncharacterized conserved protein, conta 95.91
PF05536 543 Neurochondrin: Neurochondrin 95.88
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 95.83
KOG4646173 consensus Uncharacterized conserved protein, conta 95.59
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 95.45
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 95.4
KOG3036293 consensus Protein involved in cell differentiation 95.32
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 95.14
PRK09687280 putative lyase; Provisional 94.97
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 94.85
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 94.73
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 94.45
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 94.41
PRK09687280 putative lyase; Provisional 94.39
cd00256 429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 94.11
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 94.09
KOG3678 832 consensus SARM protein (with sterile alpha and arm 93.4
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 93.08
KOG1293678 consensus Proteins containing armadillo/beta-caten 93.03
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 92.78
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 92.58
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 92.32
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 91.94
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 91.85
PTZ00429 746 beta-adaptin; Provisional 91.42
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 91.25
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 90.64
COG5096 757 Vesicle coat complex, various subunits [Intracellu 90.3
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 90.03
KOG1293 678 consensus Proteins containing armadillo/beta-caten 89.92
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 89.78
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 88.93
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 88.7
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 88.14
KOG1242 569 consensus Protein containing adaptin N-terminal re 88.0
PF11841160 DUF3361: Domain of unknown function (DUF3361) 87.29
PTZ00429 746 beta-adaptin; Provisional 87.04
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 86.6
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 86.54
KOG2973 353 consensus Uncharacterized conserved protein [Funct 86.34
PF08045257 CDC14: Cell division control protein 14, SIN compo 86.01
PF11841160 DUF3361: Domain of unknown function (DUF3361) 84.99
PF11701157 UNC45-central: Myosin-binding striated muscle asse 84.85
PF08045257 CDC14: Cell division control protein 14, SIN compo 84.82
KOG2734 536 consensus Uncharacterized conserved protein [Funct 83.99
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 83.7
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 83.3
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 82.77
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 82.19
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 80.86
COG5096 757 Vesicle coat complex, various subunits [Intracellu 80.74
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 80.38
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 80.16
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
Probab=99.88  E-value=1.5e-21  Score=215.00  Aligned_cols=194  Identities=15%  Similarity=0.109  Sum_probs=163.0

Q ss_pred             hhHHHHHHHHHHHhchhhhHHHHhcCCHHHHHHHhhcccccccchhHHHHHHHHHHHHhcCCCChhHHHhccCCCCHHHH
Q 021417          108 GRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSASSMHCM  187 (312)
Q Consensus       108 ~~~al~~l~~lak~s~~nR~~l~~aG~v~~Lv~lL~s~~~~~~~~~~~v~e~Al~iL~~L~~~~~e~k~~l~~~~~l~~l  187 (312)
                      +..|+++|+.+++++++||+||+++|++++|+.+|+.....   ......++++++|.    .+++.+..+..+++++++
T Consensus      1165 ~~~AL~kLr~LA~EserNR~~maeaGAle~L~kvLSl~~s~---s~e~a~~ElL~IL~----~~~e~~~~l~a~~~v~~L 1237 (2102)
T PLN03200       1165 PPLALGLLTQLAEGSDVNKLAMAEAGALDALTKYLSLGPQD---STEEAASELLRILF----SSPELRRHESAFGAVNQL 1237 (2102)
T ss_pred             hHHHHHHHHHHHhcCHHHHHHHHHcCCHHHHHHHHHhcCcc---chhHHHHHHHHHHh----CCHHHHHHhhhhhHHHHH
Confidence            56799999999999999999999999999999999765321   12455677777755    366777888888899999


Q ss_pred             HHHHhcCCHHHHHHHHHHHHHHhccchHH-------------HH-----HhhhhhchHHHHHHhhcCCCChHHHH-----
Q 021417          188 VWFLKSGDLSRRRNTVLVLREVISSDHRR-------------VN-----MFLEIEGAIESLYTLIKEPICPTATE-----  244 (312)
Q Consensus       188 v~~L~~gs~~~r~~Aa~lL~~Ls~~~~~~-------------~~-----~Ig~~~g~i~~LV~ll~~~~~~~a~~-----  244 (312)
                      +++|++|+.++|.+|+.+|++|... +++             ..     ..+..++++.+|++++++..++++.+     
T Consensus      1238 v~vL~~Gs~~aR~~Aa~aL~~L~~~-~~~~~~~~a~~ai~pLv~ll~~~~~~~~~~a~~ALvkL~kd~is~~a~~~~~~~ 1316 (2102)
T PLN03200       1238 VAVLRLGSRSARYSAARALQELFSA-EHIRDSELARQAVQPLVEMLNTGSESEQHAAIGALIKLSSGNPSKALAIADVEG 1316 (2102)
T ss_pred             HHHHhcCCHHHHHHHHHHHHHHHhh-hhhhhhhhhhccchHHHHHhcccchhhhHHHHHHHHHHHcCCCChHhHhhcccc
Confidence            9999999999999999999999766 442             22     33455688999999999988999999     


Q ss_pred             HHHHH----------------HHHhhcCCCCCcchHHHHHHcCcHHHHHHHhhhcccch-hhhhh-----ccCCHHHHHH
Q 021417          245 ASFVV----------------VYHMITSASAADKPIQKFVDMGLVSLLLETLVDAQRSL-CEKPW-----VFSTDFAAVI  302 (312)
Q Consensus       245 ~Al~a----------------L~~L~~~~~~~~~Nr~~~V~~G~V~~LvelL~~~~~~~-~e~aL-----L~~~~eGR~a  302 (312)
                      .++.+                +++||.+--++++||.++|++|+|++||++|.+ +++. +|+++     ||.|+|||++
T Consensus      1317 a~L~~l~~iL~~~~~~~l~~~l~~Lc~~l~~~~~~R~~~v~agaV~~LIeLL~d-e~~~~~E~Al~vLd~Lc~~eegre~ 1395 (2102)
T PLN03200       1317 NALENLCKILSSDSSLELKEDAAELCRVLFTNTRIRSTPAAARCIEPLISLLVS-ESSTAQEAGVCALDRLLDDEQLAEL 1395 (2102)
T ss_pred             hhHHHHHHhcccccchhHHHHHHHHhHHhcCChHHHhhHHHhCCHHHHHHHHhc-cCchHHHHHHHHHHHHhcCHhhHHH
Confidence            99999                888887422236899999999999999999998 6665 99999     9999999999


Q ss_pred             HhhcCCcc
Q 021417          303 TGEERPTI  310 (312)
Q Consensus       303 i~~~~~~~  310 (312)
                      +..|+.+|
T Consensus      1396 ~~~h~a~v 1403 (2102)
T PLN03200       1396 VAAHGAVV 1403 (2102)
T ss_pred             HHHcCChh
Confidence            99999987



>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-04
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 6e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-04
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 7e-04
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 2e-04
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 44.8 bits (105), Expect = 3e-05
 Identities = 33/237 (13%), Positives = 71/237 (29%), Gaps = 64/237 (27%)

Query: 8   RLINLAKWLVES--AWVALRLFQERCEEELLWAAEMIKIKAQDLKGKEVKVNTSLLYQQT 65
           RL     W + S    +  +  +E       +    IK + +             +Y + 
Sbjct: 66  RLF----WTLLSKQEEMVQKFVEEVLRINYKFLMSPIKTEQRQPSMMTR------MYIEQ 115

Query: 66  KFNLQREKSEGYAKLGIPMSSVEVLEINSKITAACKSEDQTGGR-DLVAKIKKWIKESER 124
           +  L  + ++ +AK  +                          R     K+++ + E   
Sbjct: 116 RDRLYND-NQVFAKYNVS-------------------------RLQPYLKLRQALLELRP 149

Query: 125 NKRCIVDYGAV----SVLAAA------------FESF--SKTCLDEHVSVLEEILSTLTL 166
            K  ++  G +    + +A              F+ F  +    +   +VLE +L  L  
Sbjct: 150 AKNVLI-DGVLGSGKTWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLE-MLQKLLY 207

Query: 167 LFPLAGEALTYLGSASSMHCMVWFLKSGDLSRRR---NTVLVLREVISSDHRRVNMF 220
                  + +   S   +       +   L + +   N +LVL  V   + +  N F
Sbjct: 208 QIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVLLNV--QNAKAWNAF 262


>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.8
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.79
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.76
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.75
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.75
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.75
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.73
3nmz_A458 APC variant protein; protein-protein complex, arma 99.71
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.7
3nmz_A458 APC variant protein; protein-protein complex, arma 99.69
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.68
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.68
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.65
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.63
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.62
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.58
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.56
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.56
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.56
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.54
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.53
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.53
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.51
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.51
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.5
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.5
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.49
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.49
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.47
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.47
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.47
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.45
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.44
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.43
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.42
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.4
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.4
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 99.39
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.38
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.38
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.35
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.33
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 99.33
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.18
3grl_A 651 General vesicular transport factor P115; vesicle t 99.03
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.01
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 98.91
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 98.76
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.43
3grl_A 651 General vesicular transport factor P115; vesicle t 98.32
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.86
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.78
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.67
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 97.36
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 97.34
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 97.08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.01
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 96.63
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 96.57
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 96.16
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.03
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 95.81
1z6u_A150 NP95-like ring finger protein isoform B; structura 95.72
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 95.6
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 95.54
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 95.5
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 95.24
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 94.95
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 94.59
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 94.48
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 94.46
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 94.3
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 93.95
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 93.82
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 93.76
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 93.76
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 93.72
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 93.56
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 93.24
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 93.08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 93.06
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 91.94
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 91.91
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 91.78
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 91.7
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 91.57
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 91.52
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 91.24
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 90.29
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 90.16
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 90.09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 89.2
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 88.57
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 88.5
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 88.46
1qgr_A 876 Protein (importin beta subunit); transport recepto 87.48
1qgr_A 876 Protein (importin beta subunit); transport recepto 87.0
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 86.86
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 86.37
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 85.17
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 85.1
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 83.29
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 82.98
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 82.48
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 82.14
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 81.21
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
Probab=99.80  E-value=1.2e-18  Score=156.97  Aligned_cols=178  Identities=12%  Similarity=0.083  Sum_probs=150.9

Q ss_pred             HHHHHHHHHHhcccCCCc--hhhhHHHHHHHHHHHhchhhhHHHHhcCCHHHHHHHhhcccccccchhHHHHHHHHHHHH
Q 021417           88 EVLEINSKITAACKSEDQ--TGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAAFESFSKTCLDEHVSVLEEILSTLT  165 (312)
Q Consensus        88 ~v~~ll~~l~~~~~~~d~--~~~~~al~~l~~lak~s~~nR~~l~~aG~v~~Lv~lL~s~~~~~~~~~~~v~e~Al~iL~  165 (312)
                      .+..+++.|.+    +|+  +.+..|+..|+.++.+++.||..+.++|++|.|+.+|.+.       +.+++++|..+|.
T Consensus         9 ~i~~lV~lL~s----~~~~~~~q~~Aa~~l~~L~~~~~~~r~~I~~~G~Ip~LV~lL~s~-------~~~vq~~Aa~aL~   77 (233)
T 3tt9_A            9 TLERAVSMLEA----DHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQ-------NEDVQRAVCGALR   77 (233)
T ss_dssp             CHHHHHHTCCS----SCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHTTHHHHHHHGGGCC-------CHHHHHHHHHHHH
T ss_pred             cHHHHHHHhCC----CCchHHHHHHHHHHHHHHHcCCcHHHHHHHHcCCHHHHHHHHcCC-------CHHHHHHHHHHHH
Confidence            45667777754    455  5567799999999999999999999999999999999765       3579999999999


Q ss_pred             hcCCCChhHHHhccCCCCHHHHHHHHh-cCCHHHHHHHHHHHHHHhccchHHHHHhhhhhchHHHHHHhhc---CC----
Q 021417          166 LLFPLAGEALTYLGSASSMHCMVWFLK-SGDLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIK---EP----  237 (312)
Q Consensus       166 ~L~~~~~e~k~~l~~~~~l~~lv~~L~-~gs~~~r~~Aa~lL~~Ls~~~~~~~~~Ig~~~g~i~~LV~ll~---~~----  237 (312)
                      +|+..++++|..|.+.|+|+.++++|+ +++.+.+++|+.+|.+||.. +.++..|.+  ++++.|++++.   .|    
T Consensus        78 nLa~~~~~nk~~I~~~GaI~~Lv~lL~~~~~~~~~e~a~~aL~nLS~~-~~~k~~i~~--~~i~~Lv~ll~~p~sG~~~~  154 (233)
T 3tt9_A           78 NLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITGLLWNLSSN-DKLKNLMIT--EALLTLTENIIIPFSGWPEG  154 (233)
T ss_dssp             HHHTTCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTS-GGGHHHHHH--HHHHHHCCCCCHHHHCCCGG
T ss_pred             HHHhCCHHHHHHHHHcCCHHHHHHHHccCCCHHHHHHHHHHHHHHHcC-hhhHHHHHh--ccHHHHHHHHhccccCCccc
Confidence            997767899999999999999999998 57999999999999999865 667888855  57999998763   11    


Q ss_pred             --------CChHHHHHHHHHHHHhhcCCCCCcchHHHHHHc-CcHHHHHHHhhh
Q 021417          238 --------ICPTATEASFVVVYHMITSASAADKPIQKFVDM-GLVSLLLETLVD  282 (312)
Q Consensus       238 --------~~~~a~~~Al~aL~~L~~~~~~~~~Nr~~~V~~-G~V~~LvelL~~  282 (312)
                              .++.....|.-+|.||++..   +++|..|.+. |.|+.|+.+|..
T Consensus       155 ~~~~~~~~~~~~v~~na~~~L~nLss~~---~~~R~~~r~~~Gli~~Lv~~l~~  205 (233)
T 3tt9_A          155 DYPKANGLLDFDIFYNVTGCLRNMSSAG---ADGRKAMRRCDGLIDSLVHYVRG  205 (233)
T ss_dssp             GCCCCCTTCCHHHHHHHHHHHHHHTTSC---HHHHHHHHTSTTHHHHHHHHHHH
T ss_pred             ccccccccchHHHHHHHHHHHHHHhcCC---HHHHHHHHHCCCcHHHHHHHHHh
Confidence                    25688999999999998864   4799999986 799999999975



>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.6
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.48
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.34
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.33
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.31
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.31
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.28
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.2
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.17
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.49
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.41
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 96.26
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 95.03
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 94.59
d1b3ua_588 Constant regulatory domain of protein phosphatase 93.88
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 93.41
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 93.25
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 93.18
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 92.09
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 90.52
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 90.38
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 90.13
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 86.06
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 83.14
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 82.26
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HspBP1 domain
domain: Hsp70-binding protein 1 (HspBP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=1.7e-14  Score=128.23  Aligned_cols=190  Identities=9%  Similarity=0.096  Sum_probs=156.3

Q ss_pred             CchhhhHHHHHHHHHHHhchhhhHHHHhcCCHHHHHHH-hhcccccccchhHHHHHHHHHHHHhcCCCChhHHHhccCCC
Q 021417          104 DQTGGRDLVAKIKKWIKESERNKRCIVDYGAVSVLAAA-FESFSKTCLDEHVSVLEEILSTLTLLFPLAGEALTYLGSAS  182 (312)
Q Consensus       104 d~~~~~~al~~l~~lak~s~~nR~~l~~aG~v~~Lv~l-L~s~~~~~~~~~~~v~e~Al~iL~~L~~~~~e~k~~l~~~~  182 (312)
                      |.+.+..|+..|..++.. ..|++.++..|.++.|+.. +.+.       +.+++..|+.+|..++..++..+..+.+.+
T Consensus        30 ~~~~~~~Al~~L~~L~~~-~d~a~~l~~~gg~~~ll~~ll~s~-------~~~vr~~A~~~L~~l~~~~~~~~~~~~~~~  101 (264)
T d1xqra1          30 DQQEREGALELLADLCEN-MDNAADFCQLSGMHLLVGRYLEAG-------AAGLRWRAAQLIGTCSQNVAAIQEQVLGLG  101 (264)
T ss_dssp             HHHHHHHHHHHHHHHHTS-HHHHHHHHHTTHHHHHHHTTTTCS-------SHHHHHHHHHHHHHHHTTCHHHHHHHHHTT
T ss_pred             CHHHHHHHHHHHHHHHcC-HHHHHHHHHcCCHHHHHHHHhCCC-------CHHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            345567799999999964 4588889999999988875 5433       467999999999999776677788888889


Q ss_pred             CHHHHHHHHhcC-CHHHHHHHHHHHHHHhccchHHHHHhhhhhchHHHHHHhhcCCCChHHHHHHHHHHHHhhcCCCCCc
Q 021417          183 SMHCMVWFLKSG-DLSRRRNTVLVLREVISSDHRRVNMFLEIEGAIESLYTLIKEPICPTATEASFVVVYHMITSASAAD  261 (312)
Q Consensus       183 ~l~~lv~~L~~g-s~~~r~~Aa~lL~~Ls~~~~~~~~~Ig~~~g~i~~LV~ll~~~~~~~a~~~Al~aL~~L~~~~~~~~  261 (312)
                      .++.++.+|.+. +.+.|..|+.+|..++...+.....+... |+++.|+++++++ ++.....|+.+|.+++...   +
T Consensus       102 ~i~~Lv~lL~~~~~~~v~~~a~~aL~~l~~~~~~~~~~~~~~-~gi~~L~~lL~~~-~~~~~~~a~~~L~~l~~~~---~  176 (264)
T d1xqra1         102 ALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRL-DGFSVLMRAMQQQ-VQKLKVKSAFLLQNLLVGH---P  176 (264)
T ss_dssp             HHHHHHHHHHHCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHT-THHHHHHHHHHSS-CHHHHHHHHHHHHHHHHHC---G
T ss_pred             chHHHHHHhhcCCCHHHHHHHHHHHHHHhccchhhHHHHHHh-hhhhHHHHHHhcC-chHHHHHHHHHHHHHHhcc---H
Confidence            999999999765 78899999999999987777777777565 9999999999987 8889999999999998654   4


Q ss_pred             chHHHHHHcCcHHHHHHHhhhcccchhhhhh-----cc-CCHHHHHHHhhc
Q 021417          262 KPIQKFVDMGLVSLLLETLVDAQRSLCEKPW-----VF-STDFAAVITGEE  306 (312)
Q Consensus       262 ~Nr~~~V~~G~V~~LvelL~~~~~~~~e~aL-----L~-~~~eGR~ai~~~  306 (312)
                      .++..+++.|+++.|+++|.+.+..+.+.++     |+ .+++++..+...
T Consensus       177 ~~~~~~~~~~~v~~L~~lL~~~~~~~~~~a~~aL~~L~~~~~~~~~~~~~~  227 (264)
T d1xqra1         177 EHKGTLCSMGMVQQLVALVRTEHSPFHEHVLGALCSLVTDFPQGVRECREP  227 (264)
T ss_dssp             GGHHHHHHTTHHHHHHHHHTSCCSTHHHHHHHHHHHHHTTCHHHHHHHHCG
T ss_pred             HHHHHHHHhhhHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCHHHHHHHHHh
Confidence            7999999999999999999877777777777     43 366777666543



>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure